SILENT KILLERPanel

Current Path: > > lib64 > > python2.7


Operation   : Linux premium131.web-hosting.com 4.18.0-553.44.1.lve.el8.x86_64 #1 SMP Thu Mar 13 14:29:12 UTC 2025 x86_64
Software     : Apache
Server IP    : 162.0.232.56 | Your IP: 216.73.216.111
Domains      : 1034 Domain(s)
Permission   : [ 0755 ]

Files and Folders in: //lib64//python2.7

NameTypeSizeLast ModifiedActions
Demo Directory - -
Doc Directory - -
Tools Directory - -
bsddb Directory - -
compiler Directory - -
config Directory - -
ctypes Directory - -
curses Directory - -
distutils Directory - -
email Directory - -
encodings Directory - -
ensurepip Directory - -
hotshot Directory - -
idlelib Directory - -
importlib Directory - -
json Directory - -
lib-dynload Directory - -
lib-tk Directory - -
lib2to3 Directory - -
logging Directory - -
multiprocessing Directory - -
plat-linux2 Directory - -
pydoc_data Directory - -
site-packages Directory - -
sqlite3 Directory - -
test Directory - -
unittest Directory - -
wsgiref Directory - -
xml Directory - -
BaseHTTPServer.py File 22747 bytes April 10 2024 04:58:34.
BaseHTTPServer.pyc File 21722 bytes April 10 2024 04:58:47.
BaseHTTPServer.pyo File 21722 bytes April 10 2024 04:58:47.
Bastion.py File 5744 bytes April 10 2024 04:58:34.
Bastion.pyc File 6660 bytes April 10 2024 04:58:47.
Bastion.pyo File 6660 bytes April 10 2024 04:58:47.
CGIHTTPServer.py File 13089 bytes April 10 2024 04:58:34.
CGIHTTPServer.pyc File 11018 bytes April 10 2024 04:58:47.
CGIHTTPServer.pyo File 11018 bytes April 10 2024 04:58:47.
ConfigParser.py File 27746 bytes April 10 2024 04:58:34.
ConfigParser.pyc File 25213 bytes April 10 2024 04:58:47.
ConfigParser.pyo File 25213 bytes April 10 2024 04:58:47.
Cookie.py File 26538 bytes April 10 2024 04:58:34.
Cookie.pyc File 22658 bytes April 10 2024 04:58:47.
Cookie.pyo File 22658 bytes April 10 2024 04:58:47.
DocXMLRPCServer.py File 10768 bytes April 10 2024 04:58:34.
DocXMLRPCServer.pyc File 10195 bytes April 10 2024 04:58:47.
DocXMLRPCServer.pyo File 10086 bytes April 10 2024 04:58:44.
HTMLParser.py File 17171 bytes April 10 2024 04:58:34.
HTMLParser.pyc File 13727 bytes April 10 2024 04:58:47.
HTMLParser.pyo File 13422 bytes April 10 2024 04:58:44.
MimeWriter.py File 6482 bytes April 10 2024 04:58:34.
MimeWriter.pyc File 7364 bytes April 10 2024 04:58:47.
MimeWriter.pyo File 7364 bytes April 10 2024 04:58:47.
Queue.py File 8577 bytes April 10 2024 04:58:34.
Queue.pyc File 9424 bytes April 10 2024 04:58:47.
Queue.pyo File 9424 bytes April 10 2024 04:58:47.
SimpleHTTPServer.py File 7997 bytes April 10 2024 04:58:34.
SimpleHTTPServer.pyc File 8010 bytes April 10 2024 04:58:47.
SimpleHTTPServer.pyo File 8010 bytes April 10 2024 04:58:47.
SimpleXMLRPCServer.py File 25812 bytes April 10 2024 04:58:34.
SimpleXMLRPCServer.pyc File 22863 bytes April 10 2024 04:58:47.
SimpleXMLRPCServer.pyo File 22863 bytes April 10 2024 04:58:47.
SocketServer.py File 23948 bytes April 10 2024 04:58:34.
SocketServer.pyc File 24087 bytes April 10 2024 04:58:47.
SocketServer.pyo File 24087 bytes April 10 2024 04:58:47.
StringIO.py File 10662 bytes April 10 2024 04:58:34.
StringIO.pyc File 11480 bytes April 10 2024 04:58:47.
StringIO.pyo File 11480 bytes April 10 2024 04:58:47.
UserDict.py File 7060 bytes April 10 2024 04:58:34.
UserDict.pyc File 9711 bytes April 10 2024 04:58:47.
UserDict.pyo File 9711 bytes April 10 2024 04:58:47.
UserList.py File 3644 bytes April 10 2024 04:58:34.
UserList.pyc File 6577 bytes April 10 2024 04:58:47.
UserList.pyo File 6577 bytes April 10 2024 04:58:47.
UserString.py File 9687 bytes April 10 2024 04:58:34.
UserString.pyc File 14864 bytes April 10 2024 04:58:47.
UserString.pyo File 14864 bytes April 10 2024 04:58:47.
_LWPCookieJar.py File 6553 bytes April 10 2024 04:58:34.
_LWPCookieJar.pyc File 5434 bytes April 10 2024 04:58:47.
_LWPCookieJar.pyo File 5434 bytes April 10 2024 04:58:47.
_MozillaCookieJar.py File 5797 bytes April 10 2024 04:58:34.
_MozillaCookieJar.pyc File 4461 bytes April 10 2024 04:58:47.
_MozillaCookieJar.pyo File 4422 bytes April 10 2024 04:58:44.
__future__.py File 4380 bytes April 10 2024 04:58:34.
__future__.pyc File 4223 bytes April 10 2024 04:58:47.
__future__.pyo File 4223 bytes April 10 2024 04:58:47.
__phello__.foo.py File 64 bytes April 10 2024 04:58:34.
__phello__.foo.pyc File 125 bytes April 10 2024 04:58:47.
__phello__.foo.pyo File 125 bytes April 10 2024 04:58:47.
_abcoll.py File 18619 bytes April 10 2024 04:58:34.
_abcoll.pyc File 25682 bytes April 10 2024 04:58:47.
_abcoll.pyo File 25682 bytes April 10 2024 04:58:47.
_osx_support.py File 19100 bytes April 10 2024 04:58:34.
_osx_support.pyc File 11758 bytes April 10 2024 04:58:47.
_osx_support.pyo File 11758 bytes April 10 2024 04:58:47.
_pyio.py File 69630 bytes April 10 2024 04:58:34.
_pyio.pyc File 64701 bytes April 10 2024 04:58:47.
_pyio.pyo File 64701 bytes April 10 2024 04:58:47.
_strptime.py File 20728 bytes April 10 2024 04:58:34.
_strptime.pyc File 15172 bytes April 10 2024 04:58:47.
_strptime.pyo File 15172 bytes April 10 2024 04:58:47.
_sysconfigdata.py File 19732 bytes April 10 2024 04:58:34.
_sysconfigdata.pyc File 22968 bytes April 10 2024 04:58:46.
_sysconfigdata.pyo File 22968 bytes April 10 2024 04:58:46.
_threading_local.py File 7260 bytes April 10 2024 04:58:34.
_threading_local.pyc File 6373 bytes April 10 2024 04:58:47.
_threading_local.pyo File 6373 bytes April 10 2024 04:58:47.
_weakrefset.py File 5911 bytes April 10 2024 04:58:34.
_weakrefset.pyc File 9678 bytes April 10 2024 04:58:47.
_weakrefset.pyo File 9678 bytes April 10 2024 04:58:47.
abc.py File 7145 bytes April 10 2024 04:58:34.
abc.pyc File 6143 bytes April 10 2024 04:58:47.
abc.pyo File 6087 bytes April 10 2024 04:58:44.
aifc.py File 34579 bytes April 10 2024 04:58:34.
aifc.pyc File 30459 bytes April 10 2024 04:58:47.
aifc.pyo File 30459 bytes April 10 2024 04:58:47.
antigravity.py File 60 bytes April 10 2024 04:58:34.
antigravity.pyc File 203 bytes April 10 2024 04:58:47.
antigravity.pyo File 203 bytes April 10 2024 04:58:47.
anydbm.py File 2663 bytes April 10 2024 04:58:34.
anydbm.pyc File 2800 bytes April 10 2024 04:58:47.
anydbm.pyo File 2800 bytes April 10 2024 04:58:47.
argparse.py File 89228 bytes April 10 2024 04:58:34.
argparse.pyc File 64367 bytes April 10 2024 04:58:47.
argparse.pyo File 64202 bytes April 10 2024 04:58:44.
ast.py File 11805 bytes April 10 2024 04:58:34.
ast.pyc File 12938 bytes April 10 2024 04:58:47.
ast.pyo File 12938 bytes April 10 2024 04:58:47.
asynchat.py File 11581 bytes April 10 2024 04:58:34.
asynchat.pyc File 8810 bytes April 10 2024 04:58:47.
asynchat.pyo File 8810 bytes April 10 2024 04:58:47.
asyncore.py File 20943 bytes April 10 2024 04:58:34.
asyncore.pyc File 18893 bytes April 10 2024 04:58:47.
asyncore.pyo File 18893 bytes April 10 2024 04:58:47.
atexit.py File 1705 bytes April 10 2024 04:58:34.
atexit.pyc File 2203 bytes April 10 2024 04:58:47.
atexit.pyo File 2203 bytes April 10 2024 04:58:47.
audiodev.py File 7597 bytes April 10 2024 04:58:34.
audiodev.pyc File 8469 bytes April 10 2024 04:58:47.
audiodev.pyo File 8469 bytes April 10 2024 04:58:47.
base64.py File 11806 bytes April 10 2024 04:58:34.
base64.pyc File 11297 bytes April 10 2024 04:58:47.
base64.pyo File 11297 bytes April 10 2024 04:58:47.
bdb.py File 21714 bytes April 10 2024 04:58:34.
bdb.pyc File 19101 bytes April 10 2024 04:58:47.
bdb.pyo File 19101 bytes April 10 2024 04:58:47.
binhex.py File 14698 bytes April 10 2024 04:58:34.
binhex.pyc File 15460 bytes April 10 2024 04:58:47.
binhex.pyo File 15460 bytes April 10 2024 04:58:47.
bisect.py File 2595 bytes April 10 2024 04:58:34.
bisect.pyc File 3071 bytes April 10 2024 04:58:47.
bisect.pyo File 3071 bytes April 10 2024 04:58:47.
cProfile.py File 6573 bytes April 10 2024 04:58:34.
cProfile.pyc File 6395 bytes April 10 2024 04:58:47.
cProfile.pyo File 6395 bytes April 10 2024 04:58:47.
calendar.py File 23384 bytes April 10 2024 04:58:34.
calendar.pyc File 27913 bytes April 10 2024 04:58:47.
calendar.pyo File 27913 bytes April 10 2024 04:58:47.
cgi.py File 36308 bytes April 10 2024 04:58:34.
cgi.pyc File 33366 bytes April 10 2024 04:58:47.
cgi.pyo File 33366 bytes April 10 2024 04:58:47.
cgitb.py File 12175 bytes April 10 2024 04:58:34.
cgitb.pyc File 12138 bytes April 10 2024 04:58:47.
cgitb.pyo File 12138 bytes April 10 2024 04:58:47.
chunk.py File 5419 bytes April 10 2024 04:58:34.
chunk.pyc File 5602 bytes April 10 2024 04:58:47.
chunk.pyo File 5602 bytes April 10 2024 04:58:47.
cmd.py File 15026 bytes April 10 2024 04:58:34.
cmd.pyc File 14039 bytes April 10 2024 04:58:47.
cmd.pyo File 14039 bytes April 10 2024 04:58:47.
code.py File 10189 bytes April 10 2024 04:58:34.
code.pyc File 10334 bytes April 10 2024 04:58:47.
code.pyo File 10334 bytes April 10 2024 04:58:47.
codecs.py File 36143 bytes April 10 2024 04:58:34.
codecs.pyc File 36824 bytes April 10 2024 04:58:47.
codecs.pyo File 36824 bytes April 10 2024 04:58:47.
codeop.py File 5999 bytes April 10 2024 04:58:34.
codeop.pyc File 6597 bytes April 10 2024 04:58:47.
codeop.pyo File 6597 bytes April 10 2024 04:58:47.
collections.py File 27798 bytes April 10 2024 04:58:34.
collections.pyc File 26163 bytes April 10 2024 04:58:47.
collections.pyo File 26112 bytes April 10 2024 04:58:44.
colorsys.py File 3691 bytes April 10 2024 04:58:34.
colorsys.pyc File 3991 bytes April 10 2024 04:58:47.
colorsys.pyo File 3991 bytes April 10 2024 04:58:47.
commands.py File 2545 bytes April 10 2024 04:58:34.
commands.pyc File 2469 bytes April 10 2024 04:58:47.
commands.pyo File 2469 bytes April 10 2024 04:58:47.
compileall.py File 7763 bytes April 10 2024 04:58:34.
compileall.pyc File 7017 bytes April 10 2024 04:58:47.
compileall.pyo File 7017 bytes April 10 2024 04:58:47.
contextlib.py File 4424 bytes April 10 2024 04:58:34.
contextlib.pyc File 4454 bytes April 10 2024 04:58:47.
contextlib.pyo File 4454 bytes April 10 2024 04:58:47.
cookielib.py File 65486 bytes April 10 2024 04:58:34.
cookielib.pyc File 54725 bytes April 10 2024 04:58:47.
cookielib.pyo File 54537 bytes April 10 2024 04:58:44.
copy.py File 11533 bytes April 10 2024 04:58:34.
copy.pyc File 12170 bytes April 10 2024 04:58:47.
copy.pyo File 12078 bytes April 10 2024 04:58:44.
copy_reg.py File 6974 bytes April 10 2024 04:58:34.
copy_reg.pyc File 5167 bytes April 10 2024 04:58:47.
copy_reg.pyo File 5123 bytes April 10 2024 04:58:44.
crypt.py File 2292 bytes April 10 2024 04:58:34.
crypt.pyc File 2960 bytes April 10 2024 04:58:47.
crypt.pyo File 2960 bytes April 10 2024 04:58:47.
csv.py File 16708 bytes April 10 2024 04:58:34.
csv.pyc File 13507 bytes April 10 2024 04:58:47.
csv.pyo File 13507 bytes April 10 2024 04:58:47.
dbhash.py File 498 bytes April 10 2024 04:58:34.
dbhash.pyc File 718 bytes April 10 2024 04:58:47.
dbhash.pyo File 718 bytes April 10 2024 04:58:47.
decimal.py File 221933 bytes April 10 2024 04:58:34.
decimal.pyc File 172155 bytes April 10 2024 04:58:47.
decimal.pyo File 172155 bytes April 10 2024 04:58:47.
difflib.py File 82325 bytes April 10 2024 04:58:34.
difflib.pyc File 61898 bytes April 10 2024 04:58:47.
difflib.pyo File 61847 bytes April 10 2024 04:58:44.
dircache.py File 1126 bytes April 10 2024 04:58:34.
dircache.pyc File 1576 bytes April 10 2024 04:58:47.
dircache.pyo File 1576 bytes April 10 2024 04:58:47.
dis.py File 6499 bytes April 10 2024 04:58:34.
dis.pyc File 6228 bytes April 10 2024 04:58:47.
dis.pyo File 6228 bytes April 10 2024 04:58:47.
doctest.py File 105095 bytes April 10 2024 04:58:34.
doctest.pyc File 83637 bytes April 10 2024 04:58:47.
doctest.pyo File 83350 bytes April 10 2024 04:58:44.
dumbdbm.py File 9141 bytes April 10 2024 04:58:34.
dumbdbm.pyc File 6746 bytes April 10 2024 04:58:47.
dumbdbm.pyo File 6746 bytes April 10 2024 04:58:47.
dummy_thread.py File 4418 bytes April 10 2024 04:58:34.
dummy_thread.pyc File 5394 bytes April 10 2024 04:58:47.
dummy_thread.pyo File 5394 bytes April 10 2024 04:58:47.
dummy_threading.py File 2804 bytes April 10 2024 04:58:34.
dummy_threading.pyc File 1285 bytes April 10 2024 04:58:47.
dummy_threading.pyo File 1285 bytes April 10 2024 04:58:47.
filecmp.py File 9588 bytes April 10 2024 04:58:34.
filecmp.pyc File 9622 bytes April 10 2024 04:58:47.
filecmp.pyo File 9622 bytes April 10 2024 04:58:47.
fileinput.py File 13746 bytes April 10 2024 04:58:34.
fileinput.pyc File 14500 bytes April 10 2024 04:58:47.
fileinput.pyo File 14500 bytes April 10 2024 04:58:47.
fnmatch.py File 3315 bytes April 10 2024 04:58:34.
fnmatch.pyc File 3614 bytes April 10 2024 04:58:47.
fnmatch.pyo File 3614 bytes April 10 2024 04:58:47.
formatter.py File 14911 bytes April 10 2024 04:58:34.
formatter.pyc File 19178 bytes April 10 2024 04:58:47.
formatter.pyo File 19178 bytes April 10 2024 04:58:47.
fpformat.py File 4732 bytes April 10 2024 04:58:34.
fpformat.pyc File 4703 bytes April 10 2024 04:58:47.
fpformat.pyo File 4703 bytes April 10 2024 04:58:47.
fractions.py File 22390 bytes April 10 2024 04:58:34.
fractions.pyc File 19711 bytes April 10 2024 04:58:47.
fractions.pyo File 19711 bytes April 10 2024 04:58:47.
ftplib.py File 38555 bytes April 10 2024 04:58:34.
ftplib.pyc File 34939 bytes April 10 2024 04:58:47.
ftplib.pyo File 34939 bytes April 10 2024 04:58:47.
functools.py File 4806 bytes April 10 2024 04:58:34.
functools.pyc File 6629 bytes April 10 2024 04:58:47.
functools.pyo File 6629 bytes April 10 2024 04:58:47.
genericpath.py File 3201 bytes April 10 2024 04:58:34.
genericpath.pyc File 3517 bytes April 10 2024 04:58:47.
genericpath.pyo File 3517 bytes April 10 2024 04:58:47.
getopt.py File 7319 bytes April 10 2024 04:58:34.
getopt.pyc File 6654 bytes April 10 2024 04:58:47.
getopt.pyo File 6609 bytes April 10 2024 04:58:44.
getpass.py File 5563 bytes April 10 2024 04:58:34.
getpass.pyc File 4744 bytes April 10 2024 04:58:47.
getpass.pyo File 4744 bytes April 10 2024 04:58:47.
gettext.py File 22666 bytes April 10 2024 04:58:34.
gettext.pyc File 18004 bytes April 10 2024 04:58:47.
gettext.pyo File 18004 bytes April 10 2024 04:58:47.
glob.py File 3114 bytes April 10 2024 04:58:34.
glob.pyc File 2943 bytes April 10 2024 04:58:47.
glob.pyo File 2943 bytes April 10 2024 04:58:47.
gzip.py File 19028 bytes April 10 2024 04:58:34.
gzip.pyc File 15236 bytes April 10 2024 04:58:47.
gzip.pyo File 15236 bytes April 10 2024 04:58:47.
hashlib.py File 7841 bytes April 10 2024 04:58:34.
hashlib.pyc File 6919 bytes April 10 2024 04:58:47.
hashlib.pyo File 6919 bytes April 10 2024 04:58:47.
heapq.py File 18295 bytes April 10 2024 04:58:34.
heapq.pyc File 14564 bytes April 10 2024 04:58:47.
heapq.pyo File 14564 bytes April 10 2024 04:58:47.
hmac.py File 4588 bytes April 10 2024 04:58:34.
hmac.pyc File 4542 bytes April 10 2024 04:58:47.
hmac.pyo File 4542 bytes April 10 2024 04:58:47.
htmlentitydefs.py File 18056 bytes April 10 2024 04:58:34.
htmlentitydefs.pyc File 6367 bytes April 10 2024 04:58:47.
htmlentitydefs.pyo File 6367 bytes April 10 2024 04:58:47.
htmllib.py File 12869 bytes April 10 2024 04:58:34.
htmllib.pyc File 20309 bytes April 10 2024 04:58:47.
htmllib.pyo File 20309 bytes April 10 2024 04:58:47.
httplib.py File 53306 bytes April 10 2024 04:58:34.
httplib.pyc File 38724 bytes April 10 2024 04:58:47.
httplib.pyo File 38540 bytes April 10 2024 04:58:44.
ihooks.py File 18986 bytes April 10 2024 04:58:34.
ihooks.pyc File 21372 bytes April 10 2024 04:58:47.
ihooks.pyo File 21372 bytes April 10 2024 04:58:47.
imaplib.py File 48366 bytes April 10 2024 04:58:34.
imaplib.pyc File 45011 bytes April 10 2024 04:58:47.
imaplib.pyo File 42310 bytes April 10 2024 04:58:44.
imghdr.py File 3541 bytes April 10 2024 04:58:34.
imghdr.pyc File 4838 bytes April 10 2024 04:58:47.
imghdr.pyo File 4838 bytes April 10 2024 04:58:47.
imputil.py File 25764 bytes April 10 2024 04:58:34.
imputil.pyc File 15623 bytes April 10 2024 04:58:47.
imputil.pyo File 15445 bytes April 10 2024 04:58:44.
inspect.py File 43008 bytes April 10 2024 04:58:34.
inspect.pyc File 40229 bytes April 10 2024 04:58:47.
inspect.pyo File 40229 bytes April 10 2024 04:58:47.
io.py File 3322 bytes April 10 2024 04:58:34.
io.pyc File 3589 bytes April 10 2024 04:58:47.
io.pyo File 3589 bytes April 10 2024 04:58:47.
keyword.py File 1995 bytes April 10 2024 04:58:34.
keyword.pyc File 2105 bytes April 10 2024 04:58:47.
keyword.pyo File 2105 bytes April 10 2024 04:58:47.
linecache.py File 4027 bytes April 10 2024 04:58:34.
linecache.pyc File 3272 bytes April 10 2024 04:58:47.
linecache.pyo File 3272 bytes April 10 2024 04:58:47.
locale.py File 102834 bytes April 10 2024 04:58:34.
locale.pyc File 56610 bytes April 10 2024 04:58:47.
locale.pyo File 56610 bytes April 10 2024 04:58:47.
macpath.py File 6289 bytes April 10 2024 04:58:34.
macpath.pyc File 7681 bytes April 10 2024 04:58:47.
macpath.pyo File 7681 bytes April 10 2024 04:58:47.
macurl2path.py File 2731 bytes April 10 2024 04:58:34.
macurl2path.pyc File 2244 bytes April 10 2024 04:58:47.
macurl2path.pyo File 2244 bytes April 10 2024 04:58:47.
mailbox.py File 81240 bytes April 10 2024 04:58:34.
mailbox.pyc File 76717 bytes April 10 2024 04:58:47.
mailbox.pyo File 76670 bytes April 10 2024 04:58:44.
mailcap.py File 8404 bytes April 10 2024 04:58:34.
mailcap.pyc File 7955 bytes April 10 2024 04:58:47.
mailcap.pyo File 7955 bytes April 10 2024 04:58:47.
markupbase.py File 14643 bytes April 10 2024 04:58:34.
markupbase.pyc File 9267 bytes April 10 2024 04:58:47.
markupbase.pyo File 9071 bytes April 10 2024 04:58:44.
md5.py File 358 bytes April 10 2024 04:58:34.
md5.pyc File 378 bytes April 10 2024 04:58:47.
md5.pyo File 378 bytes April 10 2024 04:58:47.
mhlib.py File 33434 bytes April 10 2024 04:58:34.
mhlib.pyc File 33777 bytes April 10 2024 04:58:47.
mhlib.pyo File 33777 bytes April 10 2024 04:58:47.
mimetools.py File 7168 bytes April 10 2024 04:58:34.
mimetools.pyc File 8201 bytes April 10 2024 04:58:47.
mimetools.pyo File 8201 bytes April 10 2024 04:58:47.
mimetypes.py File 21028 bytes April 10 2024 04:58:34.
mimetypes.pyc File 18489 bytes April 10 2024 04:58:47.
mimetypes.pyo File 18489 bytes April 10 2024 04:58:47.
mimify.py File 15020 bytes April 10 2024 04:58:34.
mimify.pyc File 12001 bytes April 10 2024 04:58:47.
mimify.pyo File 12001 bytes April 10 2024 04:58:47.
modulefinder.py File 24461 bytes April 10 2024 04:58:34.
modulefinder.pyc File 19127 bytes April 10 2024 04:58:47.
modulefinder.pyo File 19045 bytes April 10 2024 04:58:44.
multifile.py File 4820 bytes April 10 2024 04:58:34.
multifile.pyc File 5420 bytes April 10 2024 04:58:47.
multifile.pyo File 5378 bytes April 10 2024 04:58:44.
mutex.py File 1878 bytes April 10 2024 04:58:34.
mutex.pyc File 2516 bytes April 10 2024 04:58:47.
mutex.pyo File 2516 bytes April 10 2024 04:58:47.
netrc.py File 5888 bytes April 10 2024 04:58:34.
netrc.pyc File 4714 bytes April 10 2024 04:58:47.
netrc.pyo File 4714 bytes April 10 2024 04:58:47.
new.py File 610 bytes April 10 2024 04:58:34.
new.pyc File 862 bytes April 10 2024 04:58:47.
new.pyo File 862 bytes April 10 2024 04:58:47.
nntplib.py File 21470 bytes April 10 2024 04:58:34.
nntplib.pyc File 21044 bytes April 10 2024 04:58:47.
nntplib.pyo File 21044 bytes April 10 2024 04:58:47.
ntpath.py File 19429 bytes April 10 2024 04:58:34.
ntpath.pyc File 13129 bytes April 10 2024 04:58:47.
ntpath.pyo File 13129 bytes April 10 2024 04:58:47.
nturl2path.py File 2419 bytes April 10 2024 04:58:34.
nturl2path.pyc File 1815 bytes April 10 2024 04:58:47.
nturl2path.pyo File 1815 bytes April 10 2024 04:58:47.
numbers.py File 10319 bytes April 10 2024 04:58:34.
numbers.pyc File 14012 bytes April 10 2024 04:58:47.
numbers.pyo File 14012 bytes April 10 2024 04:58:47.
opcode.py File 5474 bytes April 10 2024 04:58:34.
opcode.pyc File 6145 bytes April 10 2024 04:58:47.
opcode.pyo File 6145 bytes April 10 2024 04:58:47.
optparse.py File 61203 bytes April 10 2024 04:58:34.
optparse.pyc File 53894 bytes April 10 2024 04:58:47.
optparse.pyo File 53811 bytes April 10 2024 04:58:44.
os.py File 25910 bytes April 10 2024 04:58:34.
os.pyc File 25689 bytes April 10 2024 04:58:47.
os.pyo File 25689 bytes April 10 2024 04:58:47.
os2emxpath.py File 4635 bytes April 10 2024 04:58:34.
os2emxpath.pyc File 4525 bytes April 10 2024 04:58:47.
os2emxpath.pyo File 4525 bytes April 10 2024 04:58:47.
pdb.doc File 7914 bytes April 10 2024 04:58:34.
pdb.py File 46098 bytes April 10 2024 04:58:34.
pdb.pyc File 43669 bytes April 10 2024 04:58:47.
pdb.pyo File 43669 bytes April 10 2024 04:58:47.
pickle.py File 45489 bytes April 10 2024 04:58:34.
pickle.pyc File 38560 bytes April 10 2024 04:58:47.
pickle.pyo File 38364 bytes April 10 2024 04:58:44.
pickletools.py File 74523 bytes April 10 2024 04:58:34.
pickletools.pyc File 57032 bytes April 10 2024 04:58:46.
pickletools.pyo File 56171 bytes April 10 2024 04:58:44.
pipes.py File 9582 bytes April 10 2024 04:58:34.
pipes.pyc File 9308 bytes April 10 2024 04:58:46.
pipes.pyo File 9308 bytes April 10 2024 04:58:46.
pkgutil.py File 20243 bytes April 10 2024 04:58:34.
pkgutil.pyc File 18959 bytes April 10 2024 04:58:46.
pkgutil.pyo File 18959 bytes April 10 2024 04:58:46.
platform.py File 52801 bytes April 10 2024 04:58:34.
platform.pyc File 37971 bytes April 10 2024 04:58:46.
platform.pyo File 37971 bytes April 10 2024 04:58:46.
plistlib.py File 15810 bytes April 10 2024 04:58:34.
plistlib.pyc File 19963 bytes April 10 2024 04:58:46.
plistlib.pyo File 19877 bytes April 10 2024 04:58:44.
popen2.py File 8416 bytes April 10 2024 04:58:34.
popen2.pyc File 9025 bytes April 10 2024 04:58:46.
popen2.pyo File 8983 bytes April 10 2024 04:58:44.
poplib.py File 12824 bytes April 10 2024 04:58:34.
poplib.pyc File 13345 bytes April 10 2024 04:58:46.
poplib.pyo File 13345 bytes April 10 2024 04:58:46.
posixfile.py File 8003 bytes April 10 2024 04:58:34.
posixfile.pyc File 7652 bytes April 10 2024 04:58:46.
posixfile.pyo File 7652 bytes April 10 2024 04:58:46.
posixpath.py File 14293 bytes April 10 2024 04:58:34.
posixpath.pyc File 11462 bytes April 10 2024 04:58:46.
posixpath.pyo File 11462 bytes April 10 2024 04:58:46.
pprint.py File 11777 bytes April 10 2024 04:58:34.
pprint.pyc File 10194 bytes April 10 2024 04:58:46.
pprint.pyo File 10017 bytes April 10 2024 04:58:44.
profile.py File 22781 bytes April 10 2024 04:58:34.
profile.pyc File 16456 bytes April 10 2024 04:58:46.
profile.pyo File 16209 bytes April 10 2024 04:58:44.
pstats.py File 26712 bytes April 10 2024 04:58:34.
pstats.pyc File 25013 bytes April 10 2024 04:58:46.
pstats.pyo File 25013 bytes April 10 2024 04:58:46.
pty.py File 5058 bytes April 10 2024 04:58:34.
pty.pyc File 4966 bytes April 10 2024 04:58:46.
pty.pyo File 4966 bytes April 10 2024 04:58:46.
py_compile.py File 5936 bytes April 10 2024 04:58:34.
py_compile.pyc File 6428 bytes April 10 2024 04:58:46.
py_compile.pyo File 6428 bytes April 10 2024 04:58:46.
pyclbr.py File 13388 bytes April 10 2024 04:58:34.
pyclbr.pyc File 9651 bytes April 10 2024 04:58:46.
pyclbr.pyo File 9651 bytes April 10 2024 04:58:46.
pydoc.py File 95739 bytes April 10 2024 04:58:34.
pydoc.pyc File 92342 bytes April 10 2024 04:58:46.
pydoc.pyo File 92278 bytes April 10 2024 04:58:44.
quopri.py File 6968 bytes April 10 2024 04:58:34.
quopri.pyc File 6574 bytes April 10 2024 04:58:46.
quopri.pyo File 6574 bytes April 10 2024 04:58:46.
random.py File 32457 bytes April 10 2024 04:58:34.
random.pyc File 25704 bytes April 10 2024 04:58:46.
random.pyo File 25704 bytes April 10 2024 04:58:46.
re.py File 13423 bytes April 10 2024 04:58:34.
re.pyc File 13413 bytes April 10 2024 04:58:46.
re.pyo File 13413 bytes April 10 2024 04:58:46.
repr.py File 4296 bytes April 10 2024 04:58:34.
repr.pyc File 5385 bytes April 10 2024 04:58:46.
repr.pyo File 5385 bytes April 10 2024 04:58:46.
rexec.py File 20148 bytes April 10 2024 04:58:34.
rexec.pyc File 23807 bytes April 10 2024 04:58:46.
rexec.pyo File 23807 bytes April 10 2024 04:58:46.
rfc822.py File 33542 bytes April 10 2024 04:58:34.
rfc822.pyc File 31813 bytes April 10 2024 04:58:46.
rfc822.pyo File 31813 bytes April 10 2024 04:58:46.
rlcompleter.py File 5991 bytes April 10 2024 04:58:34.
rlcompleter.pyc File 6078 bytes April 10 2024 04:58:46.
rlcompleter.pyo File 6078 bytes April 10 2024 04:58:46.
robotparser.py File 7695 bytes April 10 2024 04:58:34.
robotparser.pyc File 8003 bytes April 10 2024 04:58:46.
robotparser.pyo File 8003 bytes April 10 2024 04:58:46.
runpy.py File 11081 bytes April 10 2024 04:58:34.
runpy.pyc File 8803 bytes April 10 2024 04:58:46.
runpy.pyo File 8803 bytes April 10 2024 04:58:46.
sched.py File 5088 bytes April 10 2024 04:58:34.
sched.pyc File 4994 bytes April 10 2024 04:58:46.
sched.pyo File 4994 bytes April 10 2024 04:58:46.
sets.py File 19050 bytes April 10 2024 04:58:34.
sets.pyc File 16895 bytes April 10 2024 04:58:46.
sets.pyo File 16895 bytes April 10 2024 04:58:46.
sgmllib.py File 17884 bytes April 10 2024 04:58:34.
sgmllib.pyc File 15436 bytes April 10 2024 04:58:46.
sgmllib.pyo File 15436 bytes April 10 2024 04:58:46.
sha.py File 393 bytes April 10 2024 04:58:34.
sha.pyc File 421 bytes April 10 2024 04:58:46.
sha.pyo File 421 bytes April 10 2024 04:58:46.
shelve.py File 8178 bytes April 10 2024 04:58:34.
shelve.pyc File 10256 bytes April 10 2024 04:58:46.
shelve.pyo File 10256 bytes April 10 2024 04:58:46.
shlex.py File 11164 bytes April 10 2024 04:58:34.
shlex.pyc File 7558 bytes April 10 2024 04:58:46.
shlex.pyo File 7558 bytes April 10 2024 04:58:46.
shutil.py File 19871 bytes April 10 2024 04:58:34.
shutil.pyc File 19259 bytes April 10 2024 04:58:46.
shutil.pyo File 19259 bytes April 10 2024 04:58:46.
site.py File 21296 bytes April 10 2024 04:58:34.
site.pyc File 20786 bytes April 10 2024 04:58:46.
site.pyo File 20786 bytes April 10 2024 04:58:46.
smtpd.py File 18542 bytes April 10 2024 04:58:34.
smtpd.pyc File 15883 bytes April 10 2024 04:58:46.
smtpd.pyo File 15883 bytes April 10 2024 04:58:46.
smtplib.py File 32134 bytes April 10 2024 04:58:34.
smtplib.pyc File 30304 bytes April 10 2024 04:58:46.
smtplib.pyo File 30304 bytes April 10 2024 04:58:46.
sndhdr.py File 5973 bytes April 10 2024 04:58:34.
sndhdr.pyc File 7361 bytes April 10 2024 04:58:46.
sndhdr.pyo File 7361 bytes April 10 2024 04:58:46.
socket.py File 20615 bytes April 10 2024 04:58:34.
socket.pyc File 16152 bytes April 10 2024 04:58:46.
socket.pyo File 16066 bytes April 10 2024 04:58:44.
sre.py File 384 bytes April 10 2024 04:58:34.
sre.pyc File 519 bytes April 10 2024 04:58:46.
sre.pyo File 519 bytes April 10 2024 04:58:46.
sre_compile.py File 19823 bytes April 10 2024 04:58:34.
sre_compile.pyc File 12560 bytes April 10 2024 04:58:46.
sre_compile.pyo File 12404 bytes April 10 2024 04:58:44.
sre_constants.py File 7197 bytes April 10 2024 04:58:34.
sre_constants.pyc File 6195 bytes April 10 2024 04:58:46.
sre_constants.pyo File 6195 bytes April 10 2024 04:58:46.
sre_parse.py File 30700 bytes April 10 2024 04:58:34.
sre_parse.pyc File 21156 bytes April 10 2024 04:58:46.
sre_parse.pyo File 21156 bytes April 10 2024 04:58:46.
ssl.py File 39310 bytes April 10 2024 04:58:34.
ssl.pyc File 32716 bytes April 10 2024 04:58:46.
ssl.pyo File 32716 bytes April 10 2024 04:58:46.
stat.py File 1842 bytes April 10 2024 04:58:34.
stat.pyc File 2751 bytes April 10 2024 04:58:46.
stat.pyo File 2751 bytes April 10 2024 04:58:46.
statvfs.py File 898 bytes April 10 2024 04:58:34.
statvfs.pyc File 620 bytes April 10 2024 04:58:46.
statvfs.pyo File 620 bytes April 10 2024 04:58:46.
string.py File 21548 bytes April 10 2024 04:58:34.
string.pyc File 20459 bytes April 10 2024 04:58:46.
string.pyo File 20459 bytes April 10 2024 04:58:46.
stringold.py File 12449 bytes April 10 2024 04:58:34.
stringold.pyc File 12549 bytes April 10 2024 04:58:46.
stringold.pyo File 12549 bytes April 10 2024 04:58:46.
stringprep.py File 13522 bytes April 10 2024 04:58:34.
stringprep.pyc File 14487 bytes April 10 2024 04:58:46.
stringprep.pyo File 14415 bytes April 10 2024 04:58:44.
struct.py File 82 bytes April 10 2024 04:58:34.
struct.pyc File 239 bytes April 10 2024 04:58:46.
struct.pyo File 239 bytes April 10 2024 04:58:46.
subprocess.py File 50520 bytes April 10 2024 04:58:34.
subprocess.pyc File 32398 bytes April 10 2024 04:58:46.
subprocess.pyo File 32398 bytes April 10 2024 04:58:46.
sunau.py File 17222 bytes April 10 2024 04:58:34.
sunau.pyc File 18394 bytes April 10 2024 04:58:46.
sunau.pyo File 18394 bytes April 10 2024 04:58:46.
sunaudio.py File 1399 bytes April 10 2024 04:58:34.
sunaudio.pyc File 1987 bytes April 10 2024 04:58:46.
sunaudio.pyo File 1987 bytes April 10 2024 04:58:46.
symbol.py File 2057 bytes April 10 2024 04:58:34.
symbol.pyc File 3026 bytes April 10 2024 04:58:46.
symbol.pyo File 3026 bytes April 10 2024 04:58:46.
symtable.py File 7437 bytes April 10 2024 04:58:34.
symtable.pyc File 11786 bytes April 10 2024 04:58:46.
symtable.pyo File 11655 bytes April 10 2024 04:58:44.
sysconfig.py File 22852 bytes April 10 2024 04:58:41.
sysconfig.pyc File 17818 bytes April 10 2024 04:58:46.
sysconfig.pyo File 17818 bytes April 10 2024 04:58:46.
tabnanny.py File 11339 bytes April 10 2024 04:58:34.
tabnanny.pyc File 8247 bytes April 10 2024 04:58:46.
tabnanny.pyo File 8247 bytes April 10 2024 04:58:46.
tarfile.py File 90655 bytes April 10 2024 04:58:34.
tarfile.pyc File 76193 bytes April 10 2024 04:58:46.
tarfile.pyo File 76193 bytes April 10 2024 04:58:46.
telnetlib.py File 27036 bytes April 10 2024 04:58:34.
telnetlib.pyc File 23154 bytes April 10 2024 04:58:46.
telnetlib.pyo File 23154 bytes April 10 2024 04:58:46.
tempfile.py File 19547 bytes April 10 2024 04:58:34.
tempfile.pyc File 20344 bytes April 10 2024 04:58:46.
tempfile.pyo File 20344 bytes April 10 2024 04:58:46.
textwrap.py File 17280 bytes April 10 2024 04:58:34.
textwrap.pyc File 12097 bytes April 10 2024 04:58:46.
textwrap.pyo File 12005 bytes April 10 2024 04:58:44.
this.py File 1002 bytes April 10 2024 04:58:34.
this.pyc File 1220 bytes April 10 2024 04:58:46.
this.pyo File 1220 bytes April 10 2024 04:58:46.
threading.py File 47377 bytes April 10 2024 04:58:34.
threading.pyc File 42726 bytes April 10 2024 04:58:46.
threading.pyo File 40552 bytes April 10 2024 04:58:44.
timeit.py File 12791 bytes April 10 2024 04:58:34.
timeit.pyc File 12183 bytes April 10 2024 04:58:46.
timeit.pyo File 12183 bytes April 10 2024 04:58:46.
toaiff.py File 3142 bytes April 10 2024 04:58:34.
toaiff.pyc File 3106 bytes April 10 2024 04:58:46.
toaiff.pyo File 3106 bytes April 10 2024 04:58:46.
token.py File 2922 bytes April 10 2024 04:58:34.
token.pyc File 3816 bytes April 10 2024 04:58:46.
token.pyo File 3816 bytes April 10 2024 04:58:46.
tokenize.py File 17483 bytes April 10 2024 04:58:34.
tokenize.pyc File 14505 bytes April 10 2024 04:58:46.
tokenize.pyo File 14449 bytes April 10 2024 04:58:44.
trace.py File 29891 bytes April 10 2024 04:58:34.
trace.pyc File 22793 bytes April 10 2024 04:58:46.
trace.pyo File 22730 bytes April 10 2024 04:58:44.
traceback.py File 11285 bytes April 10 2024 04:58:34.
traceback.pyc File 11679 bytes April 10 2024 04:58:46.
traceback.pyo File 11679 bytes April 10 2024 04:58:46.
tty.py File 879 bytes April 10 2024 04:58:34.
tty.pyc File 1317 bytes April 10 2024 04:58:46.
tty.pyo File 1317 bytes April 10 2024 04:58:46.
types.py File 2094 bytes April 10 2024 04:58:34.
types.pyc File 2725 bytes April 10 2024 04:58:46.
types.pyo File 2725 bytes April 10 2024 04:58:46.
urllib.py File 60228 bytes April 10 2024 04:58:34.
urllib.pyc File 51241 bytes April 10 2024 04:58:46.
urllib.pyo File 51146 bytes April 10 2024 04:58:44.
urllib2.py File 52541 bytes April 10 2024 04:58:34.
urllib2.pyc File 47302 bytes April 10 2024 04:58:46.
urllib2.pyo File 47207 bytes April 10 2024 04:58:44.
urlparse.py File 20461 bytes April 10 2024 04:58:34.
urlparse.pyc File 18015 bytes April 10 2024 04:58:46.
urlparse.pyo File 18015 bytes April 10 2024 04:58:46.
user.py File 1627 bytes April 10 2024 04:58:34.
user.pyc File 1724 bytes April 10 2024 04:58:46.
user.pyo File 1724 bytes April 10 2024 04:58:46.
uu.py File 6697 bytes April 10 2024 04:58:34.
uu.pyc File 4390 bytes April 10 2024 04:58:46.
uu.pyo File 4390 bytes April 10 2024 04:58:46.
uuid.py File 23530 bytes April 10 2024 04:58:34.
uuid.pyc File 23366 bytes April 10 2024 04:58:46.
uuid.pyo File 23250 bytes April 10 2024 04:58:44.
warnings.py File 14823 bytes April 10 2024 04:58:34.
warnings.pyc File 13510 bytes April 10 2024 04:58:46.
warnings.pyo File 12721 bytes April 10 2024 04:58:44.
wave.py File 18582 bytes April 10 2024 04:58:34.
wave.pyc File 20013 bytes April 10 2024 04:58:46.
wave.pyo File 19869 bytes April 10 2024 04:58:44.
weakref.py File 14830 bytes April 10 2024 04:58:34.
weakref.pyc File 16441 bytes April 10 2024 04:58:46.
weakref.pyo File 16441 bytes April 10 2024 04:58:46.
webbrowser.py File 22725 bytes April 10 2024 04:58:34.
webbrowser.pyc File 19750 bytes April 10 2024 04:58:46.
webbrowser.pyo File 19705 bytes April 10 2024 04:58:44.
whichdb.py File 3379 bytes April 10 2024 04:58:34.
whichdb.pyc File 2241 bytes April 10 2024 04:58:46.
whichdb.pyo File 2241 bytes April 10 2024 04:58:46.
wsgiref.egg-info File 187 bytes April 10 2024 04:58:34.
xdrlib.py File 6069 bytes April 10 2024 04:58:34.
xdrlib.pyc File 9902 bytes April 10 2024 04:58:46.
xdrlib.pyo File 9902 bytes April 10 2024 04:58:46.
xmllib.py File 34865 bytes April 10 2024 04:58:34.
xmllib.pyc File 26848 bytes April 10 2024 04:58:46.
xmllib.pyo File 26848 bytes April 10 2024 04:58:46.
xmlrpclib.py File 52136 bytes April 10 2024 04:58:34.
xmlrpclib.pyc File 44106 bytes April 10 2024 04:58:46.
xmlrpclib.pyo File 43922 bytes April 10 2024 04:58:44.
zipfile.py File 59477 bytes April 10 2024 04:58:34.
zipfile.pyc File 42137 bytes April 10 2024 04:58:46.
zipfile.pyo File 42137 bytes April 10 2024 04:58:46.

Reading File: //lib64//python2.7/ftplib.pyc

�
zfc@sdZddlZddlZy5ddlZeZ[ddlmZee_[Wnek
rrddlZnXddlmZddgZdZ	dZ
d	Zd
efd��YZ
de
fd
��YZde
fd��YZde
fd��YZde
fd��YZe
eefZdZdfd��YZyddlZWnek
rZn9Xdefd��YZejd�e
eeejfZead�Zead�Zd�Z d�Z!d�Z"ddd�Z#dfd ��YZ$d!�Z%e&d"kr
e%�ndS(#sSAn FTP client class and some helper functions.

Based on RFC 959: File Transfer Protocol (FTP), by J. Postel and J. Reynolds

Example:

>>> from ftplib import FTP
>>> ftp = FTP('ftp.python.org') # connect to host, default port
>>> ftp.login() # default, i.e.: user anonymous, passwd anonymous@
'230 Guest login ok, access restrictions apply.'
>>> ftp.retrlines('LIST') # list directory contents
total 9
drwxr-xr-x   8 root     wheel        1024 Jan  3  1994 .
drwxr-xr-x   8 root     wheel        1024 Jan  3  1994 ..
drwxr-xr-x   2 root     wheel        1024 Jan  3  1994 bin
drwxr-xr-x   2 root     wheel        1024 Jan  3  1994 etc
d-wxrwxr-x   2 ftp      wheel        1024 Sep  5 13:43 incoming
drwxr-xr-x   2 root     wheel        1024 Nov 17  1993 lib
drwxr-xr-x   6 1094     wheel        1024 Sep 13 19:07 pub
drwxr-xr-x   3 root     wheel        1024 Jan  3  1994 usr
-rw-r--r--   1 root     root          312 Aug  1  1994 welcome.msg
'226 Transfer complete.'
>>> ftp.quit()
'221 Goodbye.'
>>>

A nice test that reveals some of the network dialogue would be:
python ftplib.py -d localhost -l -p -l
i����N(tgetfqdn(t_GLOBAL_DEFAULT_TIMEOUTtFTPtNetrciii tErrorcBseZRS((t__name__t
__module__(((s/usr/lib64/python2.7/ftplib.pyR?sterror_replycBseZRS((RR(((s/usr/lib64/python2.7/ftplib.pyR@st
error_tempcBseZRS((RR(((s/usr/lib64/python2.7/ftplib.pyRAst
error_permcBseZRS((RR(((s/usr/lib64/python2.7/ftplib.pyR	Bsterror_protocBseZRS((RR(((s/usr/lib64/python2.7/ftplib.pyR
Css
cBs�eZdZdZdZeZeZd,Z
d,Zd,ZdZ
eZdddded�Zdddd�Zd�Zd�ZeZd	�Zd
�Zd�Zd�Zd
�Zd�Zd�Zd�Zd�Zd�Zd�Z d�Z!d�Z"d�Z#d�Z$d,d�Z%d,d�Z&dddd�Z'dd,d�Z(d,d�Z)dd,d,d�Z*d,d�Z+d �Z,d!�Z-d"�Z.d#�Z/d$�Z0d%�Z1d&�Z2d'�Z3d(�Z4d)�Z5d*�Z6d+�Z7RS(-suAn FTP client class.

    To create a connection, call the class using these arguments:
            host, user, passwd, acct, timeout

    The first four arguments are all strings, and have default value ''.
    timeout must be numeric and defaults to None if not passed,
    meaning that no timeout will be set on any ftp socket(s)
    If a timeout is passed, then this is now the default timeout for all ftp
    socket operations for this instance.

    Then use self.connect() with optional host and port argument.

    To download a file, use ftp.retrlines('RETR ' + filename),
    or ftp.retrbinary() with slightly different arguments.
    To upload a file, use ftp.storlines() or ftp.storbinary(),
    which have an open file as argument (see their definitions
    below for details).
    The download/upload functions first issue appropriate TYPE
    and PORT or PASV commands.
iticCs?||_|r;|j|�|r;|j|||�q;ndS(N(ttimeouttconnecttlogin(tselfthosttusertpasswdtacctR((s/usr/lib64/python2.7/ftplib.pyt__init__vs
	
i���cCs�|dkr||_n|dkr0||_n|dkrH||_ntj|j|jf|j�|_|jj|_|jjd�|_	|j
�|_|jS(s�Connect to host.  Arguments are:
         - host: hostname to connect to (string, default previous host)
         - port: port to connect to (integer, default previous port)
        Rii���trb(RtportRtsockettcreate_connectiontsocktfamilytaftmakefiletfiletgetresptwelcome(RRRR((s/usr/lib64/python2.7/ftplib.pyR
~s$cCs(|jr!dG|j|j�GHn|jS(s`Get the welcome message from the server.
        (this is read and squirreled away by connect())s	*welcome*(t	debuggingtsanitizeR(R((s/usr/lib64/python2.7/ftplib.pyt
getwelcome�s	cCs
||_dS(s�Set the debugging level.
        The required argument level means:
        0: no debugging output (default)
        1: print commands and responses but not body text etc.
        2: also print raw lines read and sent before stripping CR/LFN(R (Rtlevel((s/usr/lib64/python2.7/ftplib.pytset_debuglevel�scCs
||_dS(s�Use passive or active mode for data transfers.
        With a false argument, use the normal PORT mode,
        With a true argument, use the PASV command.N(t
passiveserver(Rtval((s/usr/lib64/python2.7/ftplib.pytset_pasv�scCs�|d dks |d dkr~t|�}x.|dkr\||ddkr\|d}q/W|d d|d||}nt|�S(Nispass sPASS is
t*(tlentrepr(Rtsti((s/usr/lib64/python2.7/ftplib.pyR!�s #!cCsid|ksd|kr'td��n|t}|jdkrUdG|j|�GHn|jj|�dS(Ns
s
s4an illegal newline character should not be containedis*put*(t
ValueErrortCRLFR R!Rtsendall(Rtline((s/usr/lib64/python2.7/ftplib.pytputline�s
cCs/|jrdG|j|�GHn|j|�dS(Ns*cmd*(R R!R1(RR0((s/usr/lib64/python2.7/ftplib.pytputcmd�s	cCs�|jj|jd�}t|�|jkrDtd|j��n|jdkrhdG|j|�GHn|swt�n|dtkr�|d }n|dtkr�|d }n|S(Nisgot more than %d bytess*get*i����i����(	RtreadlinetmaxlineR)RR R!tEOFErrorR.(RR0((s/usr/lib64/python2.7/ftplib.pytgetline�s	

cCsx|j�}|dd!dkrt|d }xH|j�}|d|}|d |kr,|dd!dkr,Pq,q,Wn|S(Niit-s
(R6(RR0tcodetnextline((s/usr/lib64/python2.7/ftplib.pytgetmultiline�s
cCs�|j�}|jr*dG|j|�GHn|d |_|d }|d	krQ|S|dkrit|�n|dkr�t|�nt|�dS(
Ns*resp*iit1t2t3t4t5(R;R<R=(R:R R!tlastrespRR	R
(Rtresptc((s/usr/lib64/python2.7/ftplib.pyR�s	

cCs,|j�}|d dkr(t|�n|S(s%Expect a response beginning with '2'.iR<(RR(RRA((s/usr/lib64/python2.7/ftplib.pytvoidresp�scCsmdt}|jdkr.dG|j|�GHn|jj|t�|j�}|d d	krit|�ndS(
s�Abort a file transfer.  Uses out-of-band data.
        This does not follow the procedure from the RFC to send Telnet
        IP and Synch; that doesn't seem to work with the servers I've
        tried.  Instead, just send the ABOR command as OOB data.tABORis*put urgent*it426t225t226N(RERFRG(R.R R!RR/tMSG_OOBR:R
(RR0RA((s/usr/lib64/python2.7/ftplib.pytabort�s
cCs|j|�|j�S(s'Send a command and return the response.(R2R(Rtcmd((s/usr/lib64/python2.7/ftplib.pytsendcmd�s
cCs|j|�|j�S(s8Send a command and expect a response beginning with '2'.(R2RC(RRJ((s/usr/lib64/python2.7/ftplib.pytvoidcmd�s
cCsY|jd�}t|d�t|d�g}||}ddj|�}|j|�S(sUSend a PORT command with the current host and the given
        port number.
        t.isPORT t,(tsplitR*tjoinRL(RRRthbytestpbytestbytesRJ((s/usr/lib64/python2.7/ftplib.pytsendports
 
cCs�d}|jtjkr!d}n|jtjkr<d}n|dkrTtd�ndt|�|t|�dg}ddj|�}|j|�S(sESend an EPRT command with the current host and the given port number.iiisunsupported address familyRsEPRT t|(RRtAF_INETtAF_INET6R
R*RPRL(RRRRtfieldsRJ((s/usr/lib64/python2.7/ftplib.pytsendeprts		!cCsqd}d}x�tjdd|jtjdtj�D]w}|\}}}}}y&tj|||�}|j|�Wn2tjk
r�}|r�|j�nd}q4nXPq4W|dkr�|dk	r�|�q�tjd��n|j	d�|j
�d}	|jj
�d}
|jtjkr9|j
|
|	�}n|j|
|	�}|jtk	rm|j|j�n|S(s3Create a new socket and send a PORT command for it.is!getaddrinfo returns an empty listiN(tNoneRtgetaddrinfoRtSOCK_STREAMt
AI_PASSIVEtbindterrortclosetlistentgetsocknameRRVRTRYRRt
settimeout(RterrRtresRtsocktypetprotot	canonnametsaRRRA((s/usr/lib64/python2.7/ftplib.pytmakeports4.
	
cCs�|jtjkrUt|jd��\}}|jr?|}q||jj�d}n't|jd�|jj��\}}||fS(s<Internal: Does the PASV or EPSV handshake -> (address, port)tPASVitEPSV(	RRRVtparse227RKttrust_server_pasv_ipv4_addressRtgetpeernametparse229(Rtuntrusted_hostRR((s/usr/lib64/python2.7/ftplib.pytmakepasv:s		'c
Cs�d}|jr�|j�\}}tj||f|j�}yn|dk	r_|jd|�n|j|�}|ddkr�|j�}n|ddkr�t|�nWq�|j	��q�Xn�|j
�}z�|dk	r�|jd|�n|j|�}|ddkr!|j�}n|ddkr=t|�n|j�\}}	|jtk	rq|j
|j�nWd|j	�X|d dkr�t|�}n||fS(s�Initiate a transfer over the data connection.

        If the transfer is active, send a port command and the
        transfer command, and accept the connection.  If the server is
        passive, send a pasv command, connect to it, and start the
        transfer command.  Either way, return the socket for the
        connection and the expected size of the transfer.  The
        expected size may be None if it could not be determined.

        Optional `rest' argument can be a string that is sent as the
        argument to a REST command.  This is essentially a server
        marker used to tell the server to skip over any data up to the
        given marker.
        sREST %siR<R;Nit150(RZR%RrRRRRKRRR`RjtacceptRRctparse150(
RRJtresttsizeRRtconnRARtsockaddr((s/usr/lib64/python2.7/ftplib.pytntransfercmdFs>	

cCs|j||�dS(s0Like ntransfercmd() but returns only the socket.i(Rz(RRJRv((s/usr/lib64/python2.7/ftplib.pyttransfercmdscCs�|sd}n|sd}n|s-d}n|dkrR|dkrR|d}n|jd|�}|ddkr�|jd|�}n|ddkr�|jd	|�}n|dd
kr�t|�n|S(sLogin, default anonymous.t	anonymousRR7s
anonymous@sUSER iR=sPASS sACCT R<(RR7(RKR(RRRRRA((s/usr/lib64/python2.7/ftplib.pyR�s 			
i cCse|jd�|j||�}z.x'|j|�}|s>Pn||�q%WWd|j�X|j�S(s�Retrieve data in binary mode.  A new port is created for you.

        Args:
          cmd: A RETR command.
          callback: A single parameter callable to be called on each
                    block of data read.
          blocksize: The maximum number of bytes to read from the
                     socket at one time.  [default: 8192]
          rest: Passed to transfercmd().  [default: None]

        Returns:
          The response code.
        sTYPE IN(RLR{trecvR`RC(RRJtcallbackt	blocksizeRvRxtdata((s/usr/lib64/python2.7/ftplib.pyt
retrbinary�s
cCs.|d
krt}n|jd�}|j|�}d
}z�|jd�}x�|j|jd�}t|�|jkr�td|j��n|j	dkr�dGt
|�GHn|s�Pn|dtkr�|d }n|dd	kr�|d }n||�qNWWd
|r|j�n|j�X|j
�S(snRetrieve data in line mode.  A new port is created for you.

        Args:
          cmd: A RETR, LIST, NLST, or MLSD command.
          callback: An optional single parameter callable that is called
                    for each line with the trailing CRLF stripped.
                    [default: print_line()]

        Returns:
          The response code.
        sTYPE ARisgot more than %d bytesis*retr*i����i����s
N(RZt
print_lineRKR{RR3R4R)RR R*R.R`RC(RRJR~RARxtfpR0((s/usr/lib64/python2.7/ftplib.pyt	retrlines�s0	


cCs{|jd�|j||�}zDx=|j|�}|s>Pn|j|�|r%||�q%q%WWd|j�X|j�S(s9Store a file in binary mode.  A new port is created for you.

        Args:
          cmd: A STOR command.
          fp: A file-like object with a read(num_bytes) method.
          blocksize: The maximum data size to read from fp and send over
                     the connection at once.  [default: 8192]
          callback: An optional single parameter callable that is called on
                    each block of data after it is sent.  [default: None]
          rest: Passed to transfercmd().  [default: None]

        Returns:
          The response code.
        sTYPE IN(RLR{treadR/R`RC(RRJR�RR~RvRxtbuf((s/usr/lib64/python2.7/ftplib.pyt
storbinary�s

cCs�|jd�|j|�}z�x�|j|jd�}t|�|jkrctd|j��n|smPn|dtkr�|dtkr�|d }n|t}n|j|�|r"||�q"q"WWd|j�X|j	�S(shStore a file in line mode.  A new port is created for you.

        Args:
          cmd: A STOR command.
          fp: A file-like object with a readline() method.
          callback: An optional single parameter callable that is called on
                    each line after it is sent.  [default: None]

        Returns:
          The response code.
        sTYPE Aisgot more than %d bytesi����i����N(
RLR{R3R4R)RR.R/R`RC(RRJR�R~RxR�((s/usr/lib64/python2.7/ftplib.pyt	storlines�s$



cCsd|}|j|�S(sSend new account name.sACCT (RL(RtpasswordRJ((s/usr/lib64/python2.7/ftplib.pyRs
cGsBd}x|D]}|d|}q
Wg}|j||j�|S(sBReturn a list of files in a given directory (default the current).tNLSTt (R�tappend(RtargsRJtargtfiles((s/usr/lib64/python2.7/ftplib.pytnlsts
cGs�d}d}|drJt|d�td�krJ|d |d}}nx%|D]}|rQ|d|}qQqQW|j||�dS(sList a directory in long form.
        By default list current directory to stdout.
        Optional last argument is callback function; all
        non-empty arguments before it are concatenated to the
        LIST command.  (This *should* only be used for a pathname.)tLISTi����RR�N(RZttypeR�(RR�RJtfuncR�((s/usr/lib64/python2.7/ftplib.pytdirs&
cCs@|jd|�}|ddkr/t|�n|jd|�S(sRename a file.sRNFR iR=sRNTO (RKRRL(RtfromnamettonameRA((s/usr/lib64/python2.7/ftplib.pytrename+scCs4|jd|�}|d dkr'|St|�dS(sDelete a file.sDELE it250t200N(R�R�(RKR(RtfilenameRA((s/usr/lib64/python2.7/ftplib.pytdelete2scCs|dkrSy|jd�SWqhtk
rO}|jdd dkrP�qPqhXn|dkrhd}nd|}|j|�S(	sChange to a directory.s..tCDUPiit500RRMsCWD (RLR	R�(RtdirnametmsgRJ((s/usr/lib64/python2.7/ftplib.pytcwd:s
	
cCsi|jd|�}|d dkre|dj�}yt|�SWqettfk
rat|�SXndS(sRetrieve the size of a file.sSIZE it213N(RKtstriptintt
OverflowErrorR-tlong(RR�RAR+((s/usr/lib64/python2.7/ftplib.pyRwGscCs|jd|�}t|�S(s+Make a directory, return its full pathname.sMKD (RKtparse257(RR�RA((s/usr/lib64/python2.7/ftplib.pytmkdRscCs|jd|�S(sRemove a directory.sRMD (RL(RR�((s/usr/lib64/python2.7/ftplib.pytrmdWscCs|jd�}t|�S(s!Return current working directory.tPWD(RKR�(RRA((s/usr/lib64/python2.7/ftplib.pytpwd[scCs|jd�}|j�|S(sQuit, and close the connection.tQUIT(RLR`(RRA((s/usr/lib64/python2.7/ftplib.pytquit`s
cCsbz/|j}d|_|dk	r.|j�nWd|j}d|_|dk	r]|j�nXdS(s8Close the connection without assuming anything about it.N(RRZR`R(RRR((s/usr/lib64/python2.7/ftplib.pyR`fs				N(8RRt__doc__R RtFTP_PORTRtMAXLINER4RZRRRR%tFalseRnRRR
R"R$tdebugR'R!R1R2R6R:RRCRIRKRLRTRYRjRrRzR{RR�R�R�R�RR�R�R�R�R�RwR�R�R�R�R`(((s/usr/lib64/python2.7/ftplib.pyROsd										
					
	
		9$							
					tFTP_TLSc
Bs�eZdZejZddddd
d
d
ed
d�	Zddde	d�Z
d�Zd�Zd�Z
d
d�Zdd
d	�Zd
d
�Zdd
d
d�Zd
d�ZRS(s�A FTP subclass which adds TLS support to FTP as described
        in RFC-4217.

        Connect as usual to port 21 implicitly securing the FTP control
        connection before authenticating.

        Securing the data connection requires user to explicitly ask
        for it by calling prot_p() method.

        Usage example:
        >>> from ftplib import FTP_TLS
        >>> ftps = FTP_TLS('ftp.python.org')
        >>> ftps.login()  # login anonymously previously securing control channel
        '230 Guest login ok, access restrictions apply.'
        >>> ftps.prot_p()  # switch to secure data connection
        '200 Protection level set to P'
        >>> ftps.retrlines('LIST')  # list directory content securely
        total 9
        drwxr-xr-x   8 root     wheel        1024 Jan  3  1994 .
        drwxr-xr-x   8 root     wheel        1024 Jan  3  1994 ..
        drwxr-xr-x   2 root     wheel        1024 Jan  3  1994 bin
        drwxr-xr-x   2 root     wheel        1024 Jan  3  1994 etc
        d-wxrwxr-x   2 ftp      wheel        1024 Sep  5 13:43 incoming
        drwxr-xr-x   2 root     wheel        1024 Nov 17  1993 lib
        drwxr-xr-x   6 1094     wheel        1024 Sep 13 19:07 pub
        drwxr-xr-x   3 root     wheel        1024 Jan  3  1994 usr
        -rw-r--r--   1 root     root          312 Aug  1  1994 welcome.msg
        '226 Transfer complete.'
        >>> ftps.quit()
        '221 Goodbye.'
        >>>
        Rc

Cs�|dk	r'|dk	r'td��n|dk	rN|dk	rNtd��n||_||_|dkr�tj|jd|d|�}n||_t|_	t
j||||||�dS(Ns4context and keyfile arguments are mutually exclusives5context and certfile arguments are mutually exclusivetcertfiletkeyfile(RZR-R�R�tsslt_create_stdlib_contexttssl_versiontcontextR�t_prot_pRR(
RRRRRR�R�R�Rtsource_address((s/usr/lib64/python2.7/ftplib.pyR�s				cCs?|r)t|jtj�r)|j�ntj||||�S(N(t
isinstanceRR�t	SSLSockettauthRR(RRRRtsecure((s/usr/lib64/python2.7/ftplib.pyR�s
cCs�t|jtj�r$td��n|jtjkrH|jd�}n|jd�}|jj	|jd|j
�|_|jjdd�|_|S(s2Set up secure control connection by using TLS/SSL.sAlready using TLSsAUTH TLSsAUTH SSLtserver_hostnametmodeR(
R�RR�R�R-R�tPROTOCOL_SSLv23RLR�twrap_socketRRR(RRA((s/usr/lib64/python2.7/ftplib.pyR��scCs)|jd�|jd�}t|_|S(sSet up secure data connection.sPBSZ 0sPROT P(RLtTrueR�(RRA((s/usr/lib64/python2.7/ftplib.pytprot_p�s
	cCs|jd�}t|_|S(s"Set up clear text data connection.sPROT C(RLR�R�(RRA((s/usr/lib64/python2.7/ftplib.pytprot_c�s	cCsLtj|||�\}}|jrB|jj|d|j�}n||fS(NR�(RRzR�R�R�R(RRJRvRxRw((s/usr/lib64/python2.7/ftplib.pyRz�s
	i cCs�|jd�|j||�}zMx'|j|�}|s>Pn||�q%Wt|tj�rk|j�nWd|j�X|j�S(NsTYPE I(	RLR{R}R�R�R�tunwrapR`RC(RRJR~RRvRxR�((s/usr/lib64/python2.7/ftplib.pyR��s
cCs>|dkrt}n|jd�}|j|�}|jd�}z�x�|j|jd�}t|�|jkr�td|j��n|j	dkr�dGt
|�GHn|s�Pn|dtkr�|d }n|dd	kr�|d }n||�qHWt|t
j�r|j�nWd|j�|j�X|j�S(
NsTYPE ARisgot more than %d bytesis*retr*i����i����s
(RZR�RKR{RR3R4R)RR R*R.R�R�R�R�R`RC(RRJR~RARxR�R0((s/usr/lib64/python2.7/ftplib.pyR��s0	


cCs�|jd�|j||�}zcx=|j|�}|s>Pn|j|�|r%||�q%q%Wt|tj�r�|j�nWd|j�X|j	�S(NsTYPE I(
RLR{R�R/R�R�R�R�R`RC(RRJR�RR~RvRxR�((s/usr/lib64/python2.7/ftplib.pyR�	s

cCs|jd�|j|�}z�x�|j|jd�}t|�|jkrctd|j��n|smPn|dtkr�|dtkr�|d }n|t}n|j|�|r"||�q"q"Wt|t	j
�r�|j�nWd|j�X|j
�S(NsTYPE Aisgot more than %d bytesi����i����(RLR{R3R4R)RR.R/R�R�R�R�R`RC(RRJR�R~RxR�((s/usr/lib64/python2.7/ftplib.pyR�s(



N(RRR�R�R�R�RZRRR�RR�R�R�RzR�R�R�R�(((s/usr/lib64/python2.7/ftplib.pyR�xs 		
		cCs�|d dkrt|�ntdkrLddl}|jd|j�antj|�}|sedS|jd�}yt|�SWnt	t
fk
r�t|�SXdS(s�Parse the '150' response for a RETR request.
    Returns the expected transfer size or None; size is not guaranteed to
    be present in the 150 message.
    iRsi����Ns150 .* \((\d+) bytes\)i(Rt_150_reRZtretcompilet
IGNORECASEtmatchtgroupR�R�R-R�(RAR�tmR+((s/usr/lib64/python2.7/ftplib.pyRu4scCs�|d dkrt|�ntdkrFddl}|jd�antj|�}|sgt|�n|j�}dj|d �}t	|d�d>t	|d	�}||fS(
s�Parse the '227' response for a PASV request.
    Raises error_proto if it does not contain '(h1,h2,h3,h4,p1,p2)'
    Return ('host.addr.as.numbers', port#) tuple.it227i����Ns#(\d+),(\d+),(\d+),(\d+),(\d+),(\d+)RMiii(
Rt_227_reRZR�R�tsearchR
tgroupsRPR�(RAR�R�tnumbersRR((s/usr/lib64/python2.7/ftplib.pyRmKs"cCs�|d dkrt|�n|jd�}|dkrCt|�n|jd|d�}|dkrqt|�n||d||dkr�t|�n||d|!j||d�}t|�dkr�t|�n|d}t|d�}||fS(s�Parse the '229' response for an EPSV request.
    Raises error_proto if it does not contain '(|||port|)'
    Return ('host.addr.as.numbers', port#) tuple.it229t(it)ii(RtfindR
ROR)R�(RAtpeertlefttrighttpartsRR((s/usr/lib64/python2.7/ftplib.pyRp_s "
cCs�|d dkrt|�n|dd!dkr3dSd}d}t|�}xg||kr�||}|d}|dkr�||ks�||dkr�Pn|d}n||}qNW|S(s�Parse the '257' response for a MKD or PWD request.
    This is a response to a MKD or PWD request: a directory name.
    Returns the directoryname in the 257 reply.it257is "Rit"(RR)(RAR�R,tnRB((s/usr/lib64/python2.7/ftplib.pyR�us 


cCs	|GHdS(s+Default retrlines callback to print a line.N((R0((s/usr/lib64/python2.7/ftplib.pyR��sRtIc	Cs�|s|}nd|}|j|�|j|�t|jd��\}}|j||�|jd|�}|d d	kr�t�n|jd|�}|d d
kr�t�n|j�|j�dS(s+Copy file from one FTP-instance to another.sTYPE RksSTOR it125RssRETR N(R�Rs(R�Rs(RLRmRKRTR
RC(	tsourcet
sourcenamettargett
targetnameR�t
sourcehostt
sourceportttreplytsreply((s/usr/lib64/python2.7/ftplib.pytftpcp�s	


		
cBsPeZdZdZdZdZdd�Zd�Zd�Z	d�Z
d�ZRS(s�Class to parse & provide access to 'netrc' format files.

    See the netrc(4) man page for information on the file format.

    WARNING: This class is obsolete -- use module netrc instead.

    cCs|dkrFdtjkr:tjjtjdd�}qFtd�ni|_i|_t|d�}d}x�|j	|j
d�}t|�|j
kr�td|j
��n|s�Pn|r�|j
�r�|j|�qpn"|rt|�|j|<d}n|j�}d}}	}
}d}d}
x.|
t|�kr\||
}|
dt|�krr||
d}nd}|dkr�d}n�|d	kr�|r�|j�}|
d}
n�|d
kr�|r�|}	|
d}
nr|dkr|r|}
|
d}
nM|dkr'|r'|}|
d}
n(|d
krO|rO|}g}d}Pn|
d}
q/W|r�|	po|j|_|
p�|j|_|p�|j|_n|rp||jkr�|j|\}}}|	p�|}	|
p�|}
|p�|}n|	|
|f|j|<qpqpW|j�dS(NtHOMEs.netrcs!specify file to load or set $HOMEtriisgot more than %d bytestdefaulttmachineRR�taccounttmacdef(RZtostenvirontpathRPtIOErrort
_Netrc__hostst_Netrc__macrostopenR3R4R)RR�R�ttupleROtlowert_Netrc__defusert_Netrc__defpasswdt_Netrc__defacctR`(RR�R�tin_macroR0tmacro_linest
macro_nametwordsRRRRR�R,tw1tw2tousertopasswdtoacct((s/usr/lib64/python2.7/ftplib.pyR�s~			
	
	



cCs
|jj�S(s4Return a list of hosts mentioned in the .netrc file.(R�tkeys(R((s/usr/lib64/python2.7/ftplib.pyt	get_hosts�scCs||j�}d}}}||jkrB|j|\}}}n|pN|j}|p]|j}|pl|j}|||fS(s�Returns login information for the named host.

        The return value is a triple containing userid,
        password, and the accounting field.

        N(R�RZR�R�R�R�(RRRRR((s/usr/lib64/python2.7/ftplib.pytget_account�scCs
|jj�S(s)Return a list of all defined macro names.(R�R(R((s/usr/lib64/python2.7/ftplib.pyt
get_macrosscCs|j|S(s6Return a sequence of lines which define a named macro.(R�(Rtmacro((s/usr/lib64/python2.7/ftplib.pyt	get_macrosN(RRR�RZR�R�R�RRRRR	(((s/usr/lib64/python2.7/ftplib.pyR�sC			cCs4ttj�dkr-tjGHtjd�nd}d}x+tjddkrf|d}tjd=q<Wtjdd dkr�tjdd}tjd=ntjd}t|�}|j|�d}}}yt	|�}Wn0t
k
r|dk	rStjjd�qSnAXy|j
|�\}}}Wn!tk
rRtjjd�nX|j|||�x�tjdD]�}|d d	kr�|j|d�qt|d dkr�d
}	|dr�|	d|d}	n|j|	�}
qt|dkr|j|j�qt|jd
|tjjd�qtW|j�dS(s�Test program.
    Usage: ftp [-d] [-r[file]] host [-l[dir]] [-d[dir]] [-p] [file] ...

    -d dir
    -l list
    -p password
    iiis-ds-rRs5Could not open account file -- using anonymous login.s$No account -- using anonymous login.s-ltCWDR�s-psRETR iN(R)tsystargvttestR�texitRZRR$RR�tstderrtwriteRtKeyErrorRR�RKR'R%R�tstdoutR�(R trcfileRtftptuseridRRtnetrcRRJRA((s/usr/lib64/python2.7/ftplib.pyR
sN	





	

t__main__('R�R�RtSOCKSRRtImportErrorRt__all__RHR�R�t	ExceptionRRRR	R
R�R5t
all_errorsR.RR�R�R�tSSLErrorRZR�RuR�RmRpR�R�R�RR
R(((s/usr/lib64/python2.7/ftplib.pyt<module>sZ
	
��&
�
					m	7

SILENT KILLER Tool