SILENT KILLERPanel

Current Path: > > opt > alt > > > > python27 > lib64 > python2.7


Operation   : Linux premium131.web-hosting.com 4.18.0-553.44.1.lve.el8.x86_64 #1 SMP Thu Mar 13 14:29:12 UTC 2025 x86_64
Software     : Apache
Server IP    : 162.0.232.56 | Your IP: 216.73.216.111
Domains      : 1034 Domain(s)
Permission   : [ 0755 ]

Files and Folders in: //opt/alt////python27/lib64/python2.7

NameTypeSizeLast ModifiedActions
bsddb Directory - -
compiler Directory - -
config Directory - -
ctypes Directory - -
curses Directory - -
distutils Directory - -
email Directory - -
encodings Directory - -
ensurepip Directory - -
hotshot Directory - -
idlelib Directory - -
importlib Directory - -
json Directory - -
lib-dynload Directory - -
lib2to3 Directory - -
logging Directory - -
multiprocessing Directory - -
plat-linux2 Directory - -
pydoc_data Directory - -
site-packages Directory - -
sqlite3 Directory - -
test Directory - -
unittest Directory - -
wsgiref Directory - -
xml Directory - -
BaseHTTPServer.py File 22747 bytes January 08 2025 10:43:40.
BaseHTTPServer.pyc File 21982 bytes January 08 2025 10:43:03.
BaseHTTPServer.pyo File 21982 bytes January 08 2025 10:43:03.
Bastion.py File 5744 bytes January 08 2025 10:43:11.
Bastion.pyc File 6855 bytes January 08 2025 10:42:51.
Bastion.pyo File 6855 bytes January 08 2025 10:42:51.
CGIHTTPServer.py File 13089 bytes January 08 2025 10:43:27.
CGIHTTPServer.pyc File 11187 bytes January 08 2025 10:43:39.
CGIHTTPServer.pyo File 11187 bytes January 08 2025 10:43:39.
ConfigParser.py File 27746 bytes January 08 2025 10:43:11.
ConfigParser.pyc File 25980 bytes January 08 2025 10:43:11.
ConfigParser.pyo File 25980 bytes January 08 2025 10:43:11.
Cookie.py File 26538 bytes January 08 2025 10:43:04.
Cookie.pyc File 23152 bytes January 08 2025 10:43:41.
Cookie.pyo File 23152 bytes January 08 2025 10:43:41.
DocXMLRPCServer.py File 10768 bytes January 08 2025 10:43:11.
DocXMLRPCServer.pyc File 10442 bytes January 08 2025 10:43:35.
DocXMLRPCServer.pyo File 10333 bytes January 08 2025 10:43:08.
HTMLParser.py File 17171 bytes January 08 2025 10:42:55.
HTMLParser.pyc File 14143 bytes January 08 2025 10:42:55.
HTMLParser.pyo File 13838 bytes January 08 2025 10:43:35.
MimeWriter.py File 6482 bytes January 08 2025 10:42:52.
MimeWriter.pyc File 7481 bytes January 08 2025 10:43:04.
MimeWriter.pyo File 7481 bytes January 08 2025 10:43:04.
Queue.py File 8577 bytes January 08 2025 10:43:11.
Queue.pyc File 9788 bytes January 08 2025 10:43:04.
Queue.pyo File 9788 bytes January 08 2025 10:43:04.
SimpleHTTPServer.py File 7997 bytes January 08 2025 10:43:03.
SimpleHTTPServer.pyc File 8153 bytes January 08 2025 10:42:51.
SimpleHTTPServer.pyo File 8153 bytes January 08 2025 10:42:51.
SimpleXMLRPCServer.py File 25812 bytes January 08 2025 10:43:42.
SimpleXMLRPCServer.pyc File 23331 bytes January 08 2025 10:43:05.
SimpleXMLRPCServer.pyo File 23331 bytes January 08 2025 10:43:05.
SocketServer.py File 23948 bytes January 08 2025 10:43:28.
SocketServer.pyc File 24828 bytes January 08 2025 10:43:04.
SocketServer.pyo File 24828 bytes January 08 2025 10:43:04.
StringIO.py File 10662 bytes January 08 2025 10:43:31.
StringIO.pyc File 11727 bytes January 08 2025 10:43:39.
StringIO.pyo File 11727 bytes January 08 2025 10:43:39.
UserDict.py File 7060 bytes January 08 2025 10:43:04.
UserDict.pyc File 10296 bytes January 21 2025 11:47:01.
UserDict.pyo File 10296 bytes January 08 2025 10:43:04.
UserList.py File 3644 bytes January 08 2025 10:43:35.
UserList.pyc File 7019 bytes January 08 2025 10:43:31.
UserList.pyo File 7019 bytes January 08 2025 10:43:31.
UserString.py File 9697 bytes January 08 2025 10:43:35.
UserString.pyc File 15748 bytes January 08 2025 10:43:27.
UserString.pyo File 15748 bytes January 08 2025 10:43:27.
_LWPCookieJar.py File 6553 bytes January 08 2025 10:43:41.
_LWPCookieJar.pyc File 5512 bytes January 08 2025 10:43:11.
_LWPCookieJar.pyo File 5512 bytes January 08 2025 10:43:11.
_MozillaCookieJar.py File 5797 bytes January 08 2025 10:42:58.
_MozillaCookieJar.pyc File 4513 bytes January 08 2025 10:43:04.
_MozillaCookieJar.pyo File 4474 bytes January 08 2025 10:43:35.
__future__.py File 4380 bytes January 08 2025 10:43:39.
__future__.pyc File 4301 bytes January 08 2025 10:43:03.
__future__.pyo File 4301 bytes January 08 2025 10:43:03.
__phello__.foo.py File 64 bytes January 08 2025 10:43:35.
__phello__.foo.pyc File 138 bytes January 08 2025 10:43:05.
__phello__.foo.pyo File 138 bytes January 08 2025 10:43:05.
_abcoll.py File 18619 bytes January 08 2025 10:43:11.
_abcoll.pyc File 27034 bytes January 21 2025 11:47:01.
_abcoll.pyo File 27034 bytes January 08 2025 10:43:35.
_osx_support.py File 19100 bytes January 08 2025 10:43:35.
_osx_support.pyc File 12005 bytes January 08 2025 10:43:04.
_osx_support.pyo File 12005 bytes January 08 2025 10:43:04.
_pyio.py File 69630 bytes January 08 2025 10:43:11.
_pyio.pyc File 66976 bytes January 08 2025 10:43:38.
_pyio.pyo File 66976 bytes January 08 2025 10:43:38.
_strptime.py File 20728 bytes January 08 2025 10:43:38.
_strptime.pyc File 15432 bytes January 08 2025 10:43:35.
_strptime.pyo File 15432 bytes January 08 2025 10:43:35.
_sysconfigdata.py File 21163 bytes January 08 2025 10:43:35.
_sysconfigdata.pyc File 24277 bytes January 21 2025 11:47:01.
_sysconfigdata.pyo File 24277 bytes January 08 2025 10:42:56.
_threading_local.py File 7260 bytes January 08 2025 10:43:03.
_threading_local.pyc File 6490 bytes January 08 2025 10:43:11.
_threading_local.pyo File 6490 bytes January 08 2025 10:43:11.
_weakrefset.py File 5911 bytes January 08 2025 10:42:58.
_weakrefset.pyc File 10302 bytes January 21 2025 11:47:01.
_weakrefset.pyo File 10302 bytes January 08 2025 10:43:40.
abc.py File 7145 bytes January 08 2025 10:43:03.
abc.pyc File 6286 bytes January 21 2025 11:47:01.
abc.pyo File 6230 bytes January 08 2025 10:43:04.
aifc.py File 34579 bytes January 08 2025 10:43:39.
aifc.pyc File 31408 bytes January 08 2025 10:43:42.
aifc.pyo File 31408 bytes January 08 2025 10:43:42.
antigravity.py File 60 bytes January 08 2025 10:43:05.
antigravity.pyc File 216 bytes January 08 2025 10:42:55.
antigravity.pyo File 216 bytes January 08 2025 10:42:55.
anydbm.py File 2663 bytes January 08 2025 10:42:56.
anydbm.pyc File 2839 bytes January 08 2025 10:42:51.
anydbm.pyo File 2839 bytes January 08 2025 10:42:51.
argparse.py File 89228 bytes January 08 2025 10:43:35.
argparse.pyc File 66382 bytes January 08 2025 10:43:01.
argparse.pyo File 66217 bytes January 08 2025 10:43:11.
ast.py File 11805 bytes January 08 2025 10:43:35.
ast.pyc File 13250 bytes January 08 2025 10:42:56.
ast.pyo File 13250 bytes January 08 2025 10:42:56.
asynchat.py File 11581 bytes January 08 2025 10:43:27.
asynchat.pyc File 9200 bytes January 08 2025 10:43:01.
asynchat.pyo File 9200 bytes January 08 2025 10:43:01.
asyncore.py File 20943 bytes January 08 2025 10:43:40.
asyncore.pyc File 19660 bytes January 08 2025 10:43:00.
asyncore.pyo File 19660 bytes January 08 2025 10:43:00.
atexit.py File 1705 bytes January 08 2025 10:43:35.
atexit.pyc File 2281 bytes January 08 2025 10:42:55.
atexit.pyo File 2281 bytes January 08 2025 10:42:55.
audiodev.py File 7597 bytes January 08 2025 10:43:35.
audiodev.pyc File 8820 bytes January 08 2025 10:43:42.
audiodev.pyo File 8820 bytes January 08 2025 10:43:42.
base64.py File 11816 bytes January 08 2025 10:43:08.
base64.pyc File 11531 bytes January 08 2025 10:43:41.
base64.pyo File 11531 bytes January 08 2025 10:43:41.
bdb.py File 21714 bytes January 08 2025 10:43:27.
bdb.pyc File 19894 bytes January 08 2025 10:43:08.
bdb.pyo File 19894 bytes January 08 2025 10:43:08.
binhex.py File 14698 bytes January 08 2025 10:43:03.
binhex.pyc File 16123 bytes January 08 2025 10:43:11.
binhex.pyo File 16123 bytes January 08 2025 10:43:11.
bisect.py File 2595 bytes January 08 2025 10:42:51.
bisect.pyc File 3136 bytes January 08 2025 10:43:27.
bisect.pyo File 3136 bytes January 08 2025 10:43:27.
cProfile.py File 6583 bytes January 08 2025 10:42:56.
cProfile.pyc File 6577 bytes January 08 2025 10:42:56.
cProfile.pyo File 6577 bytes January 08 2025 10:42:56.
calendar.py File 23384 bytes January 08 2025 10:43:31.
calendar.pyc File 28940 bytes January 08 2025 10:43:35.
calendar.pyo File 28940 bytes January 08 2025 10:43:35.
cgi.py File 35807 bytes January 08 2025 10:43:35.
cgi.pyc File 34034 bytes January 08 2025 10:43:00.
cgi.pyo File 34034 bytes January 08 2025 10:43:00.
cgitb.py File 12175 bytes January 08 2025 10:43:40.
cgitb.pyc File 12372 bytes January 08 2025 10:43:35.
cgitb.pyo File 12372 bytes January 08 2025 10:43:35.
chunk.py File 5419 bytes January 08 2025 10:43:11.
chunk.pyc File 5745 bytes January 08 2025 10:43:41.
chunk.pyo File 5745 bytes January 08 2025 10:43:41.
cmd.py File 15026 bytes January 08 2025 10:42:55.
cmd.pyc File 14312 bytes January 08 2025 10:43:35.
cmd.pyo File 14312 bytes January 08 2025 10:43:35.
code.py File 10189 bytes January 08 2025 10:43:05.
code.pyc File 10542 bytes January 08 2025 10:43:27.
code.pyo File 10542 bytes January 08 2025 10:43:27.
codecs.py File 36143 bytes January 08 2025 10:43:04.
codecs.pyc File 38046 bytes January 21 2025 11:47:01.
codecs.pyo File 38046 bytes January 08 2025 10:42:56.
codeop.py File 5999 bytes January 08 2025 10:42:59.
codeop.pyc File 6727 bytes January 08 2025 10:43:04.
codeop.pyo File 6727 bytes January 08 2025 10:43:04.
collections.py File 27798 bytes January 08 2025 10:43:04.
collections.pyc File 26839 bytes January 08 2025 10:43:35.
collections.pyo File 26788 bytes January 08 2025 10:43:03.
colorsys.py File 3691 bytes January 08 2025 10:43:03.
colorsys.pyc File 4095 bytes January 08 2025 10:43:09.
colorsys.pyo File 4095 bytes January 08 2025 10:43:09.
commands.py File 2545 bytes January 08 2025 10:42:58.
commands.pyc File 2547 bytes January 08 2025 10:43:00.
commands.pyo File 2547 bytes January 08 2025 10:43:00.
compileall.py File 7763 bytes January 08 2025 10:42:59.
compileall.pyc File 7095 bytes January 08 2025 10:43:35.
compileall.pyo File 7095 bytes January 08 2025 10:43:35.
contextlib.py File 4424 bytes January 08 2025 10:42:59.
contextlib.pyc File 4610 bytes January 08 2025 10:43:35.
contextlib.pyo File 4610 bytes January 08 2025 10:43:35.
cookielib.py File 65486 bytes January 08 2025 10:43:05.
cookielib.pyc File 55986 bytes January 08 2025 10:43:39.
cookielib.pyo File 55798 bytes January 08 2025 10:43:27.
copy.py File 11533 bytes January 08 2025 10:43:03.
copy.pyc File 12508 bytes January 08 2025 10:43:35.
copy.pyo File 12416 bytes January 08 2025 10:43:27.
copy_reg.py File 6974 bytes January 08 2025 10:43:11.
copy_reg.pyc File 5310 bytes January 21 2025 11:47:01.
copy_reg.pyo File 5266 bytes January 08 2025 10:43:35.
crypt.py File 2291 bytes January 08 2025 10:43:03.
crypt.pyc File 3025 bytes January 08 2025 10:43:00.
crypt.pyo File 3025 bytes January 08 2025 10:43:00.
csv.py File 16708 bytes January 08 2025 10:43:04.
csv.pyc File 13884 bytes January 08 2025 10:43:27.
csv.pyo File 13884 bytes January 08 2025 10:43:27.
dbhash.py File 498 bytes January 08 2025 10:42:55.
dbhash.pyc File 744 bytes January 08 2025 10:43:03.
dbhash.pyo File 744 bytes January 08 2025 10:43:03.
decimal.py File 221933 bytes January 08 2025 10:43:28.
decimal.pyc File 175470 bytes January 08 2025 10:42:55.
decimal.pyo File 175470 bytes January 08 2025 10:42:55.
difflib.py File 82325 bytes January 08 2025 10:43:08.
difflib.pyc File 62600 bytes January 08 2025 10:43:05.
difflib.pyo File 62549 bytes January 08 2025 10:43:41.
dircache.py File 1126 bytes January 08 2025 10:42:55.
dircache.pyc File 1628 bytes January 08 2025 10:43:08.
dircache.pyo File 1628 bytes January 08 2025 10:43:08.
dis.py File 6499 bytes January 08 2025 10:43:04.
dis.pyc File 6332 bytes January 08 2025 10:43:31.
dis.pyo File 6332 bytes January 08 2025 10:43:31.
doctest.py File 105095 bytes January 08 2025 10:43:04.
doctest.pyc File 85210 bytes January 08 2025 10:43:03.
doctest.pyo File 84923 bytes January 08 2025 10:42:56.
dumbdbm.py File 9141 bytes January 08 2025 10:43:04.
dumbdbm.pyc File 6993 bytes January 08 2025 10:43:39.
dumbdbm.pyo File 6993 bytes January 08 2025 10:43:39.
dummy_thread.py File 4418 bytes January 08 2025 10:43:05.
dummy_thread.pyc File 5589 bytes January 08 2025 10:43:05.
dummy_thread.pyo File 5589 bytes January 08 2025 10:43:05.
dummy_threading.py File 2804 bytes January 08 2025 10:43:03.
dummy_threading.pyc File 1298 bytes January 08 2025 10:43:39.
dummy_threading.pyo File 1298 bytes January 08 2025 10:43:39.
filecmp.py File 9588 bytes January 08 2025 10:43:03.
filecmp.pyc File 9882 bytes January 08 2025 10:43:28.
filecmp.pyo File 9882 bytes January 08 2025 10:43:28.
fileinput.py File 13746 bytes January 08 2025 10:43:08.
fileinput.pyc File 14890 bytes January 08 2025 10:43:35.
fileinput.pyo File 14890 bytes January 08 2025 10:43:35.
fnmatch.py File 3315 bytes January 08 2025 10:43:03.
fnmatch.pyc File 3692 bytes January 08 2025 10:43:00.
fnmatch.pyo File 3692 bytes January 08 2025 10:43:00.
formatter.py File 14911 bytes January 08 2025 10:43:04.
formatter.pyc File 20179 bytes January 08 2025 10:43:03.
formatter.pyo File 20179 bytes January 08 2025 10:43:03.
fpformat.py File 4732 bytes January 08 2025 10:43:28.
fpformat.pyc File 4807 bytes January 08 2025 10:43:11.
fpformat.pyo File 4807 bytes January 08 2025 10:43:11.
fractions.py File 22390 bytes January 08 2025 10:42:56.
fractions.pyc File 20218 bytes January 08 2025 10:43:00.
fractions.pyo File 20218 bytes January 08 2025 10:43:00.
ftplib.py File 38194 bytes January 08 2025 10:43:03.
ftplib.pyc File 35652 bytes January 08 2025 10:42:56.
ftplib.pyo File 35652 bytes January 08 2025 10:42:56.
functools.py File 4806 bytes January 08 2025 10:43:42.
functools.pyc File 7019 bytes January 08 2025 10:43:05.
functools.pyo File 7019 bytes January 08 2025 10:43:05.
genericpath.py File 3201 bytes January 08 2025 10:43:41.
genericpath.pyc File 3660 bytes January 21 2025 11:47:01.
genericpath.pyo File 3660 bytes January 08 2025 10:43:35.
getopt.py File 7319 bytes January 08 2025 10:43:35.
getopt.pyc File 6784 bytes January 08 2025 10:43:35.
getopt.pyo File 6739 bytes January 08 2025 10:43:40.
getpass.py File 5563 bytes January 08 2025 10:42:56.
getpass.pyc File 4835 bytes January 08 2025 10:43:35.
getpass.pyo File 4835 bytes January 08 2025 10:43:35.
gettext.py File 22666 bytes January 08 2025 10:43:35.
gettext.pyc File 18602 bytes January 08 2025 10:43:42.
gettext.pyo File 18602 bytes January 08 2025 10:43:42.
glob.py File 3114 bytes January 08 2025 10:42:59.
glob.pyc File 3047 bytes January 08 2025 10:43:03.
glob.pyo File 3047 bytes January 08 2025 10:43:03.
gzip.py File 19028 bytes January 08 2025 10:43:35.
gzip.pyc File 15626 bytes January 08 2025 10:43:04.
gzip.pyo File 15626 bytes January 08 2025 10:43:04.
hashlib.py File 7842 bytes January 08 2025 10:43:39.
hashlib.pyc File 7026 bytes January 08 2025 10:43:39.
hashlib.pyo File 7026 bytes January 08 2025 10:43:39.
heapq.py File 18295 bytes January 08 2025 10:42:52.
heapq.pyc File 14798 bytes January 08 2025 10:43:04.
heapq.pyo File 14798 bytes January 08 2025 10:43:04.
hmac.py File 4588 bytes January 08 2025 10:43:11.
hmac.pyc File 4672 bytes January 08 2025 10:43:35.
hmac.pyo File 4672 bytes January 08 2025 10:43:35.
htmlentitydefs.py File 18056 bytes January 08 2025 10:43:04.
htmlentitydefs.pyc File 6380 bytes January 08 2025 10:43:04.
htmlentitydefs.pyo File 6380 bytes January 08 2025 10:43:04.
htmllib.py File 12869 bytes January 08 2025 10:43:08.
htmllib.pyc File 21492 bytes January 08 2025 10:42:59.
htmllib.pyo File 21492 bytes January 08 2025 10:42:59.
httplib.py File 52300 bytes January 08 2025 10:43:35.
httplib.pyc File 38793 bytes January 08 2025 10:43:11.
httplib.pyo File 38609 bytes January 08 2025 10:43:40.
ihooks.py File 18986 bytes January 08 2025 10:43:11.
ihooks.pyc File 22269 bytes January 08 2025 10:43:04.
ihooks.pyo File 22269 bytes January 08 2025 10:43:04.
imaplib.py File 48366 bytes January 08 2025 10:43:34.
imaplib.pyc File 46272 bytes January 08 2025 10:43:03.
imaplib.pyo File 43506 bytes January 08 2025 10:43:04.
imghdr.py File 3541 bytes January 08 2025 10:43:35.
imghdr.pyc File 5046 bytes January 08 2025 10:43:05.
imghdr.pyo File 5046 bytes January 08 2025 10:43:05.
imputil.py File 25764 bytes January 08 2025 10:43:03.
imputil.pyc File 16117 bytes January 08 2025 10:43:28.
imputil.pyo File 15939 bytes January 08 2025 10:43:31.
inspect.py File 43008 bytes January 08 2025 10:43:27.
inspect.pyc File 41126 bytes January 08 2025 10:43:31.
inspect.pyo File 41126 bytes January 08 2025 10:43:31.
io.py File 3322 bytes January 08 2025 10:43:04.
io.pyc File 3654 bytes January 08 2025 10:43:00.
io.pyo File 3654 bytes January 08 2025 10:43:00.
keyword.py File 2005 bytes January 08 2025 10:43:35.
keyword.pyc File 2131 bytes January 08 2025 10:43:42.
keyword.pyo File 2131 bytes January 08 2025 10:43:42.
linecache.py File 4027 bytes January 08 2025 10:43:05.
linecache.pyc File 3350 bytes January 21 2025 11:47:01.
linecache.pyo File 3350 bytes January 08 2025 10:42:55.
locale.py File 102834 bytes January 08 2025 10:43:27.
locale.pyc File 57026 bytes January 08 2025 10:42:51.
locale.pyo File 57026 bytes January 08 2025 10:42:51.
macpath.py File 6289 bytes January 08 2025 10:43:04.
macpath.pyc File 7928 bytes January 08 2025 10:43:03.
macpath.pyo File 7928 bytes January 08 2025 10:43:03.
macurl2path.py File 2731 bytes January 08 2025 10:43:03.
macurl2path.pyc File 2296 bytes January 08 2025 10:43:27.
macurl2path.pyo File 2296 bytes January 08 2025 10:43:27.
mailbox.py File 81240 bytes January 08 2025 10:43:27.
mailbox.pyc File 79564 bytes January 08 2025 10:43:35.
mailbox.pyo File 79517 bytes January 08 2025 10:43:03.
mailcap.py File 7429 bytes January 08 2025 10:42:56.
mailcap.pyc File 7248 bytes January 08 2025 10:43:08.
mailcap.pyo File 7248 bytes January 08 2025 10:43:08.
markupbase.py File 14643 bytes January 08 2025 10:43:40.
markupbase.pyc File 9488 bytes January 08 2025 10:43:38.
markupbase.pyo File 9292 bytes January 08 2025 10:42:55.
md5.py File 358 bytes January 08 2025 10:43:40.
md5.pyc File 391 bytes January 08 2025 10:43:03.
md5.pyo File 391 bytes January 08 2025 10:43:03.
mhlib.py File 33434 bytes January 08 2025 10:43:28.
mhlib.pyc File 34791 bytes January 08 2025 10:43:28.
mhlib.pyo File 34791 bytes January 08 2025 10:43:28.
mimetools.py File 7168 bytes January 08 2025 10:43:11.
mimetools.pyc File 8461 bytes January 08 2025 10:43:39.
mimetools.pyo File 8461 bytes January 08 2025 10:43:39.
mimetypes.py File 21028 bytes January 08 2025 10:43:27.
mimetypes.pyc File 18736 bytes January 08 2025 10:43:35.
mimetypes.pyo File 18736 bytes January 08 2025 10:43:35.
mimify.py File 15030 bytes January 08 2025 10:43:05.
mimify.pyc File 12196 bytes January 08 2025 10:43:27.
mimify.pyo File 12196 bytes January 08 2025 10:43:27.
modulefinder.py File 24461 bytes January 08 2025 10:43:03.
modulefinder.pyc File 19582 bytes January 08 2025 10:42:56.
modulefinder.pyo File 19500 bytes January 08 2025 10:42:55.
multifile.py File 4820 bytes January 08 2025 10:43:27.
multifile.pyc File 5615 bytes January 08 2025 10:43:31.
multifile.pyo File 5573 bytes January 08 2025 10:42:52.
mutex.py File 1878 bytes January 08 2025 10:43:01.
mutex.pyc File 2607 bytes January 08 2025 10:43:27.
mutex.pyo File 2607 bytes January 08 2025 10:43:27.
netrc.py File 5888 bytes January 08 2025 10:43:11.
netrc.pyc File 4831 bytes January 08 2025 10:43:27.
netrc.pyo File 4831 bytes January 08 2025 10:43:27.
new.py File 610 bytes January 08 2025 10:43:35.
new.pyc File 875 bytes January 08 2025 10:42:58.
new.pyo File 875 bytes January 08 2025 10:42:58.
nntplib.py File 21470 bytes January 08 2025 10:42:55.
nntplib.pyc File 21616 bytes January 08 2025 10:43:31.
nntplib.pyo File 21616 bytes January 08 2025 10:43:31.
ntpath.py File 19429 bytes January 08 2025 10:42:58.
ntpath.pyc File 13415 bytes January 08 2025 10:43:11.
ntpath.pyo File 13415 bytes January 08 2025 10:43:11.
nturl2path.py File 2419 bytes January 08 2025 10:43:35.
nturl2path.pyc File 1854 bytes January 08 2025 10:43:04.
nturl2path.pyo File 1854 bytes January 08 2025 10:43:04.
numbers.py File 10319 bytes January 08 2025 10:43:39.
numbers.pyc File 14818 bytes January 08 2025 10:43:05.
numbers.pyo File 14818 bytes January 08 2025 10:43:05.
opcode.py File 5474 bytes January 08 2025 10:43:41.
opcode.pyc File 6210 bytes January 08 2025 10:42:56.
opcode.pyo File 6210 bytes January 08 2025 10:42:56.
optparse.py File 61203 bytes January 08 2025 10:43:35.
optparse.pyc File 55714 bytes January 08 2025 10:43:35.
optparse.pyo File 55631 bytes January 08 2025 10:43:39.
os.py File 25910 bytes January 08 2025 10:43:00.
os.pyc File 26378 bytes January 21 2025 11:47:01.
os.pyo File 26378 bytes January 08 2025 10:43:31.
os2emxpath.py File 4635 bytes January 08 2025 10:43:04.
os2emxpath.pyc File 4642 bytes January 08 2025 10:43:42.
os2emxpath.pyo File 4642 bytes January 08 2025 10:43:42.
pdb.doc File 7914 bytes January 08 2025 10:43:03.
pdb.py File 46108 bytes January 08 2025 10:43:05.
pdb.pyc File 45151 bytes January 08 2025 10:43:39.
pdb.pyo File 45151 bytes January 08 2025 10:43:39.
pickle.py File 45489 bytes January 08 2025 10:43:11.
pickle.pyc File 39912 bytes January 08 2025 10:43:39.
pickle.pyo File 39716 bytes January 08 2025 10:43:27.
pickletools.py File 74523 bytes January 08 2025 10:43:03.
pickletools.pyc File 57448 bytes January 08 2025 10:43:31.
pickletools.pyo File 56587 bytes January 08 2025 10:42:59.
pipes.py File 9582 bytes January 08 2025 10:43:35.
pipes.pyc File 9516 bytes January 08 2025 10:43:35.
pipes.pyo File 9516 bytes January 08 2025 10:43:35.
pkgutil.py File 20243 bytes January 08 2025 10:43:04.
pkgutil.pyc File 19388 bytes January 08 2025 10:43:04.
pkgutil.pyo File 19388 bytes January 08 2025 10:43:04.
platform.py File 52798 bytes January 08 2025 10:43:04.
platform.pyc File 38602 bytes January 08 2025 10:43:05.
platform.pyo File 38602 bytes January 08 2025 10:43:05.
plistlib.py File 15185 bytes January 08 2025 10:42:51.
plistlib.pyc File 20008 bytes January 08 2025 10:43:35.
plistlib.pyo File 19922 bytes January 08 2025 10:43:11.
popen2.py File 8416 bytes January 08 2025 10:43:39.
popen2.pyc File 9233 bytes January 08 2025 10:43:35.
popen2.pyo File 9191 bytes January 08 2025 10:43:03.
poplib.py File 12824 bytes January 08 2025 10:42:55.
poplib.pyc File 13774 bytes January 08 2025 10:43:04.
poplib.pyo File 13774 bytes January 08 2025 10:43:04.
posixfile.py File 8003 bytes January 08 2025 10:43:11.
posixfile.pyc File 7808 bytes January 08 2025 10:42:59.
posixfile.pyo File 7808 bytes January 08 2025 10:42:59.
posixpath.py File 14293 bytes January 08 2025 10:43:05.
posixpath.pyc File 11761 bytes January 21 2025 11:47:01.
posixpath.pyo File 11761 bytes January 08 2025 10:43:35.
pprint.py File 11777 bytes January 08 2025 10:43:04.
pprint.pyc File 10441 bytes January 08 2025 10:43:28.
pprint.pyo File 10264 bytes January 08 2025 10:43:27.
profile.py File 22791 bytes January 08 2025 10:43:09.
profile.pyc File 16963 bytes January 08 2025 10:43:38.
profile.pyo File 16716 bytes January 08 2025 10:43:09.
pstats.py File 26712 bytes January 08 2025 10:43:01.
pstats.pyc File 25793 bytes January 08 2025 10:42:55.
pstats.pyo File 25793 bytes January 08 2025 10:42:55.
pty.py File 5058 bytes January 08 2025 10:42:55.
pty.pyc File 5096 bytes January 08 2025 10:43:38.
pty.pyo File 5096 bytes January 08 2025 10:43:38.
py_compile.py File 5936 bytes January 08 2025 10:43:28.
py_compile.pyc File 6519 bytes January 08 2025 10:42:55.
py_compile.pyo File 6519 bytes January 08 2025 10:42:55.
pyclbr.py File 13388 bytes January 08 2025 10:42:51.
pyclbr.pyc File 9820 bytes January 08 2025 10:43:39.
pyclbr.pyo File 9820 bytes January 08 2025 10:43:39.
pydoc.py File 95676 bytes January 08 2025 10:43:04.
pydoc.pyc File 94914 bytes January 08 2025 10:43:04.
pydoc.pyo File 94850 bytes January 08 2025 10:43:37.
quopri.py File 6978 bytes January 08 2025 10:43:35.
quopri.pyc File 6717 bytes January 08 2025 10:43:11.
quopri.pyo File 6717 bytes January 08 2025 10:43:11.
random.py File 32457 bytes January 08 2025 10:42:55.
random.pyc File 26263 bytes January 08 2025 10:43:03.
random.pyo File 26263 bytes January 08 2025 10:43:03.
re.py File 13423 bytes January 08 2025 10:43:06.
re.pyc File 13686 bytes January 21 2025 11:47:01.
re.pyo File 13686 bytes January 08 2025 10:43:27.
repr.py File 4296 bytes January 08 2025 10:43:42.
repr.pyc File 5606 bytes January 08 2025 10:43:08.
repr.pyo File 5606 bytes January 08 2025 10:43:08.
rexec.py File 20148 bytes January 08 2025 10:43:05.
rexec.pyc File 24574 bytes January 08 2025 10:43:27.
rexec.pyo File 24574 bytes January 08 2025 10:43:27.
rfc822.py File 33542 bytes January 08 2025 10:43:35.
rfc822.pyc File 32593 bytes January 08 2025 10:43:40.
rfc822.pyo File 32593 bytes January 08 2025 10:43:40.
rlcompleter.py File 5991 bytes January 08 2025 10:43:42.
rlcompleter.pyc File 6182 bytes January 08 2025 10:43:11.
rlcompleter.pyo File 6182 bytes January 08 2025 10:43:11.
robotparser.py File 7695 bytes January 08 2025 10:43:03.
robotparser.pyc File 8315 bytes January 08 2025 10:43:28.
robotparser.pyo File 8315 bytes January 08 2025 10:43:28.
runpy.py File 11081 bytes January 08 2025 10:42:55.
runpy.pyc File 9063 bytes January 08 2025 10:43:27.
runpy.pyo File 9063 bytes January 08 2025 10:43:27.
sched.py File 5088 bytes January 08 2025 10:43:28.
sched.pyc File 5111 bytes January 08 2025 10:42:56.
sched.pyo File 5111 bytes January 08 2025 10:42:56.
sets.py File 19050 bytes January 08 2025 10:43:40.
sets.pyc File 17623 bytes January 08 2025 10:43:05.
sets.pyo File 17623 bytes January 08 2025 10:43:05.
sgmllib.py File 17884 bytes January 08 2025 10:42:55.
sgmllib.pyc File 16047 bytes January 08 2025 10:42:59.
sgmllib.pyo File 16047 bytes January 08 2025 10:42:59.
sha.py File 393 bytes January 08 2025 10:43:27.
sha.pyc File 434 bytes January 08 2025 10:43:00.
sha.pyo File 434 bytes January 08 2025 10:43:00.
shelve.py File 8178 bytes January 08 2025 10:43:35.
shelve.pyc File 10607 bytes January 08 2025 10:43:35.
shelve.pyo File 10607 bytes January 08 2025 10:43:35.
shlex.py File 11164 bytes January 08 2025 10:43:39.
shlex.pyc File 7727 bytes January 08 2025 10:42:51.
shlex.pyo File 7727 bytes January 08 2025 10:42:51.
shutil.py File 19871 bytes January 08 2025 10:43:31.
shutil.pyc File 19649 bytes January 08 2025 10:43:27.
shutil.pyo File 19649 bytes January 08 2025 10:43:27.
site.py File 19637 bytes January 08 2025 10:43:27.
site.pyc File 19819 bytes January 21 2025 11:47:01.
site.pyo File 19819 bytes January 08 2025 10:43:27.
smtpd.py File 18552 bytes January 08 2025 10:43:05.
smtpd.pyc File 16286 bytes January 08 2025 10:43:11.
smtpd.pyo File 16286 bytes January 08 2025 10:43:11.
smtplib.py File 32144 bytes January 08 2025 10:43:03.
smtplib.pyc File 31019 bytes January 08 2025 10:42:59.
smtplib.pyo File 31019 bytes January 08 2025 10:42:59.
sndhdr.py File 5973 bytes January 08 2025 10:43:35.
sndhdr.pyc File 7582 bytes January 08 2025 10:43:34.
sndhdr.pyo File 7582 bytes January 08 2025 10:43:34.
socket.py File 20615 bytes January 08 2025 10:43:39.
socket.pyc File 16542 bytes January 08 2025 10:43:00.
socket.pyo File 16456 bytes January 08 2025 10:43:35.
sre.py File 384 bytes January 08 2025 10:42:59.
sre.pyc File 532 bytes January 08 2025 10:43:00.
sre.pyo File 532 bytes January 08 2025 10:43:00.
sre_compile.py File 19823 bytes January 08 2025 10:43:03.
sre_compile.pyc File 12755 bytes January 21 2025 11:47:01.
sre_compile.pyo File 12599 bytes January 08 2025 10:43:35.
sre_constants.py File 7197 bytes January 08 2025 10:43:00.
sre_constants.pyc File 6260 bytes January 21 2025 11:47:01.
sre_constants.pyo File 6260 bytes January 08 2025 10:43:04.
sre_parse.py File 30700 bytes January 08 2025 10:43:05.
sre_parse.pyc File 21624 bytes January 21 2025 11:47:01.
sre_parse.pyo File 21624 bytes January 08 2025 10:43:09.
ssl.py File 37455 bytes January 08 2025 10:43:27.
ssl.pyc File 33015 bytes January 08 2025 10:43:28.
ssl.pyo File 33015 bytes January 08 2025 10:43:28.
stat.py File 1842 bytes January 08 2025 10:43:28.
stat.pyc File 2881 bytes January 21 2025 11:47:01.
stat.pyo File 2881 bytes January 08 2025 10:43:11.
statvfs.py File 898 bytes January 08 2025 10:43:03.
statvfs.pyc File 633 bytes January 08 2025 10:43:05.
statvfs.pyo File 633 bytes January 08 2025 10:43:05.
string.py File 21548 bytes January 08 2025 10:43:35.
string.pyc File 21122 bytes January 08 2025 10:43:35.
string.pyo File 21122 bytes January 08 2025 10:43:35.
stringold.py File 12449 bytes January 08 2025 10:42:55.
stringold.pyc File 12900 bytes January 08 2025 10:42:55.
stringold.pyo File 12900 bytes January 08 2025 10:42:55.
stringprep.py File 13522 bytes January 08 2025 10:43:11.
stringprep.pyc File 14747 bytes January 08 2025 10:43:05.
stringprep.pyo File 14675 bytes January 08 2025 10:43:11.
struct.py File 82 bytes January 08 2025 10:43:05.
struct.pyc File 252 bytes January 08 2025 10:43:31.
struct.pyo File 252 bytes January 08 2025 10:43:31.
subprocess.py File 50520 bytes January 08 2025 10:42:56.
subprocess.pyc File 33100 bytes January 08 2025 10:43:11.
subprocess.pyo File 33100 bytes January 08 2025 10:43:11.
sunau.py File 17222 bytes January 08 2025 10:43:04.
sunau.pyc File 19018 bytes January 08 2025 10:43:35.
sunau.pyo File 19018 bytes January 08 2025 10:43:35.
sunaudio.py File 1399 bytes January 08 2025 10:43:40.
sunaudio.pyc File 2052 bytes January 08 2025 10:43:35.
sunaudio.pyo File 2052 bytes January 08 2025 10:43:35.
symbol.py File 2067 bytes January 08 2025 10:43:03.
symbol.pyc File 3052 bytes January 08 2025 10:42:55.
symbol.pyo File 3052 bytes January 08 2025 10:42:55.
symtable.py File 7437 bytes January 08 2025 10:43:35.
symtable.pyc File 12436 bytes January 08 2025 10:43:11.
symtable.pyo File 12305 bytes January 08 2025 10:42:55.
sysconfig.py File 22852 bytes January 08 2025 10:43:31.
sysconfig.pyc File 18156 bytes January 21 2025 11:47:01.
sysconfig.pyo File 18153 bytes January 08 2025 10:43:31.
tabnanny.py File 11349 bytes January 08 2025 10:43:35.
tabnanny.pyc File 8507 bytes January 08 2025 10:43:35.
tabnanny.pyo File 8507 bytes January 08 2025 10:43:35.
tarfile.py File 90568 bytes January 08 2025 10:43:04.
tarfile.pyc File 78374 bytes January 08 2025 10:43:35.
tarfile.pyo File 78374 bytes January 08 2025 10:43:35.
telnetlib.py File 27036 bytes January 08 2025 10:43:03.
telnetlib.pyc File 23583 bytes January 08 2025 10:43:38.
telnetlib.pyo File 23583 bytes January 08 2025 10:43:38.
tempfile.py File 19547 bytes January 08 2025 10:42:56.
tempfile.pyc File 21046 bytes January 08 2025 10:43:39.
tempfile.pyo File 21046 bytes January 08 2025 10:43:39.
textwrap.py File 17280 bytes January 08 2025 10:42:58.
textwrap.pyc File 12279 bytes January 08 2025 10:43:28.
textwrap.pyo File 12187 bytes January 08 2025 10:42:55.
this.py File 1002 bytes January 08 2025 10:43:11.
this.pyc File 1233 bytes January 08 2025 10:43:35.
this.pyo File 1233 bytes January 08 2025 10:43:35.
threading.py File 47282 bytes January 08 2025 10:43:27.
threading.pyc File 43999 bytes January 08 2025 10:43:04.
threading.pyo File 41825 bytes January 08 2025 10:42:59.
timeit.py File 12801 bytes January 08 2025 10:43:04.
timeit.pyc File 12352 bytes January 08 2025 10:43:31.
timeit.pyo File 12352 bytes January 08 2025 10:43:31.
toaiff.py File 3142 bytes January 08 2025 10:43:39.
toaiff.pyc File 3158 bytes January 08 2025 10:43:04.
toaiff.pyo File 3158 bytes January 08 2025 10:43:04.
token.py File 2922 bytes January 08 2025 10:42:59.
token.pyc File 3881 bytes January 08 2025 10:42:51.
token.pyo File 3881 bytes January 08 2025 10:42:51.
tokenize.py File 17483 bytes January 08 2025 10:43:31.
tokenize.pyc File 14713 bytes January 08 2025 10:43:41.
tokenize.pyo File 14657 bytes January 08 2025 10:42:59.
trace.py File 29901 bytes January 08 2025 10:42:55.
trace.pyc File 23235 bytes January 08 2025 10:43:03.
trace.pyo File 23172 bytes January 08 2025 10:43:31.
traceback.py File 11285 bytes January 08 2025 10:43:34.
traceback.pyc File 11939 bytes January 21 2025 11:47:01.
traceback.pyo File 11939 bytes January 08 2025 10:43:31.
tty.py File 879 bytes January 08 2025 10:42:55.
tty.pyc File 1356 bytes January 08 2025 10:42:56.
tty.pyo File 1356 bytes January 08 2025 10:42:56.
types.py File 2094 bytes January 08 2025 10:42:56.
types.pyc File 2816 bytes January 21 2025 11:47:01.
types.pyo File 2816 bytes January 08 2025 10:43:04.
urllib.py File 60228 bytes January 08 2025 10:43:03.
urllib.pyc File 52580 bytes January 08 2025 10:43:37.
urllib.pyo File 52485 bytes January 08 2025 10:43:09.
urllib2.py File 52537 bytes January 08 2025 10:43:35.
urllib2.pyc File 48949 bytes January 08 2025 10:43:34.
urllib2.pyo File 48854 bytes January 08 2025 10:43:27.
urlparse.py File 16678 bytes January 08 2025 10:43:11.
urlparse.pyc File 15886 bytes January 08 2025 10:43:08.
urlparse.pyo File 15886 bytes January 08 2025 10:43:08.
user.py File 1627 bytes January 08 2025 10:43:03.
user.pyc File 1737 bytes January 08 2025 10:43:03.
user.pyo File 1737 bytes January 08 2025 10:43:03.
uu.py File 6707 bytes January 08 2025 10:42:59.
uu.pyc File 4455 bytes January 08 2025 10:43:27.
uu.pyo File 4455 bytes January 08 2025 10:43:27.
uuid.py File 23175 bytes January 08 2025 10:43:04.
uuid.pyc File 23778 bytes January 08 2025 10:43:05.
uuid.pyo File 23662 bytes January 08 2025 10:42:56.
warnings.py File 14823 bytes January 08 2025 10:43:04.
warnings.pyc File 13809 bytes January 21 2025 11:47:01.
warnings.pyo File 13020 bytes January 08 2025 10:43:41.
wave.py File 18582 bytes January 08 2025 10:43:03.
wave.pyc File 20676 bytes January 08 2025 10:43:27.
wave.pyo File 20532 bytes January 08 2025 10:43:05.
weakref.py File 14830 bytes January 08 2025 10:43:28.
weakref.pyc File 17130 bytes January 08 2025 10:43:05.
weakref.pyo File 17130 bytes January 08 2025 10:43:05.
webbrowser.py File 22735 bytes January 08 2025 10:43:35.
webbrowser.pyc File 20335 bytes January 08 2025 10:42:55.
webbrowser.pyo File 20290 bytes January 08 2025 10:43:27.
whichdb.py File 3388 bytes January 08 2025 10:43:11.
whichdb.pyc File 2267 bytes January 08 2025 10:43:27.
whichdb.pyo File 2267 bytes January 08 2025 10:43:27.
wsgiref.egg-info File 187 bytes January 08 2025 10:42:51.
xdrlib.py File 6069 bytes January 08 2025 10:43:40.
xdrlib.pyc File 10448 bytes January 08 2025 10:43:38.
xdrlib.pyo File 10448 bytes January 08 2025 10:43:38.
xmllib.py File 34865 bytes January 08 2025 10:42:56.
xmllib.pyc File 27550 bytes January 08 2025 10:43:35.
xmllib.pyo File 27550 bytes January 08 2025 10:43:35.
xmlrpclib.py File 52136 bytes January 08 2025 10:43:31.
xmlrpclib.pyc File 45887 bytes January 08 2025 10:43:27.
xmlrpclib.pyo File 45703 bytes January 08 2025 10:43:04.
zipfile.py File 59477 bytes January 08 2025 10:43:40.
zipfile.pyc File 42930 bytes January 08 2025 10:43:34.
zipfile.pyo File 42930 bytes January 08 2025 10:43:34.

Reading File: //opt/alt////python27/lib64/python2.7/ftplib.pyo

�
�V~gc@sdZddlZddlZy5ddlZeZ[ddlmZee_[Wnek
rrddlZnXddlmZddgZdZ	dZ
d	Zd
efd��YZ
de
fd
��YZde
fd��YZde
fd��YZde
fd��YZe
eefZdZdfd��YZyddlZWnek
rZn9Xdefd��YZejd�e
eeejfZead�Zead�Zd�Z d�Z!d�Z"ddd�Z#dfd ��YZ$d!�Z%e&d"kr
e%�ndS(#sSAn FTP client class and some helper functions.

Based on RFC 959: File Transfer Protocol (FTP), by J. Postel and J. Reynolds

Example:

>>> from ftplib import FTP
>>> ftp = FTP('ftp.python.org') # connect to host, default port
>>> ftp.login() # default, i.e.: user anonymous, passwd anonymous@
'230 Guest login ok, access restrictions apply.'
>>> ftp.retrlines('LIST') # list directory contents
total 9
drwxr-xr-x   8 root     wheel        1024 Jan  3  1994 .
drwxr-xr-x   8 root     wheel        1024 Jan  3  1994 ..
drwxr-xr-x   2 root     wheel        1024 Jan  3  1994 bin
drwxr-xr-x   2 root     wheel        1024 Jan  3  1994 etc
d-wxrwxr-x   2 ftp      wheel        1024 Sep  5 13:43 incoming
drwxr-xr-x   2 root     wheel        1024 Nov 17  1993 lib
drwxr-xr-x   6 1094     wheel        1024 Sep 13 19:07 pub
drwxr-xr-x   3 root     wheel        1024 Jan  3  1994 usr
-rw-r--r--   1 root     root          312 Aug  1  1994 welcome.msg
'226 Transfer complete.'
>>> ftp.quit()
'221 Goodbye.'
>>>

A nice test that reveals some of the network dialogue would be:
python ftplib.py -d localhost -l -p -l
i����N(tgetfqdn(t_GLOBAL_DEFAULT_TIMEOUTtFTPtNetrciii tErrorcBseZRS((t__name__t
__module__(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR?sterror_replycBseZRS((RR(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR@st
error_tempcBseZRS((RR(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyRAst
error_permcBseZRS((RR(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR	Bsterror_protocBseZRS((RR(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR
Css
cBs�eZdZdZdZeZeZd,Z
d,Zd,ZdZ
dddded�Zdddd�Zd�Zd�ZeZd	�Zd
�Zd�Zd�Zd
�Zd�Zd�Zd�Zd�Zd�Zd�Zd�Zd�Z d�Z!d�Z"d,d�Z#d,d�Z$dddd�Z%dd,d�Z&d,d�Z'dd,d,d�Z(d,d�Z)d �Z*d!�Z+d"�Z,d#�Z-d$�Z.d%�Z/d&�Z0d'�Z1d(�Z2d)�Z3d*�Z4d+�Z5RS(-suAn FTP client class.

    To create a connection, call the class using these arguments:
            host, user, passwd, acct, timeout

    The first four arguments are all strings, and have default value ''.
    timeout must be numeric and defaults to None if not passed,
    meaning that no timeout will be set on any ftp socket(s)
    If a timeout is passed, then this is now the default timeout for all ftp
    socket operations for this instance.

    Then use self.connect() with optional host and port argument.

    To download a file, use ftp.retrlines('RETR ' + filename),
    or ftp.retrbinary() with slightly different arguments.
    To upload a file, use ftp.storlines() or ftp.storbinary(),
    which have an open file as argument (see their definitions
    below for details).
    The download/upload functions first issue appropriate TYPE
    and PORT or PASV commands.
iticCs?||_|r;|j|�|r;|j|||�q;ndS(N(ttimeouttconnecttlogin(tselfthosttusertpasswdtacctR((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt__init__ts
	
i���cCs�|dkr||_n|dkr0||_n|dkrH||_ntj|j|jf|j�|_|jj|_|jjd�|_	|j
�|_|jS(s�Connect to host.  Arguments are:
         - host: hostname to connect to (string, default previous host)
         - port: port to connect to (integer, default previous port)
        Rii���trb(RtportRtsockettcreate_connectiontsocktfamilytaftmakefiletfiletgetresptwelcome(RRRR((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR
|s$cCs(|jr!dG|j|j�GHn|jS(s`Get the welcome message from the server.
        (this is read and squirreled away by connect())s	*welcome*(t	debuggingtsanitizeR(R((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt
getwelcome�s	cCs
||_dS(s�Set the debugging level.
        The required argument level means:
        0: no debugging output (default)
        1: print commands and responses but not body text etc.
        2: also print raw lines read and sent before stripping CR/LFN(R (Rtlevel((s+/opt/alt/python27/lib64/python2.7/ftplib.pytset_debuglevel�scCs
||_dS(s�Use passive or active mode for data transfers.
        With a false argument, use the normal PORT mode,
        With a true argument, use the PASV command.N(t
passiveserver(Rtval((s+/opt/alt/python27/lib64/python2.7/ftplib.pytset_pasv�scCs�|d dks |d dkr~t|�}x.|dkr\||ddkr\|d}q/W|d d|d||}nt|�S(Nispass sPASS is
t*(tlentrepr(Rtsti((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR!�s #!cCsid|ksd|kr'td��n|t}|jdkrUdG|j|�GHn|jj|�dS(Ns
s
s4an illegal newline character should not be containedis*put*(t
ValueErrortCRLFR R!Rtsendall(Rtline((s+/opt/alt/python27/lib64/python2.7/ftplib.pytputline�s
cCs/|jrdG|j|�GHn|j|�dS(Ns*cmd*(R R!R1(RR0((s+/opt/alt/python27/lib64/python2.7/ftplib.pytputcmd�s	cCs�|jj|jd�}t|�|jkrDtd|j��n|jdkrhdG|j|�GHn|swt�n|dtkr�|d }n|dtkr�|d }n|S(Nisgot more than %d bytess*get*i����i����(	RtreadlinetmaxlineR)RR R!tEOFErrorR.(RR0((s+/opt/alt/python27/lib64/python2.7/ftplib.pytgetline�s	

cCsx|j�}|dd!dkrt|d }xH|j�}|d|}|d |kr,|dd!dkr,Pq,q,Wn|S(Niit-s
(R6(RR0tcodetnextline((s+/opt/alt/python27/lib64/python2.7/ftplib.pytgetmultiline�s
cCs�|j�}|jr*dG|j|�GHn|d |_|d }|d	krQ|S|dkrit|�n|dkr�t|�nt|�dS(
Ns*resp*iit1t2t3t4t5(R;R<R=(R:R R!tlastrespRR	R
(Rtresptc((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�s	

cCs,|j�}|d dkr(t|�n|S(s%Expect a response beginning with '2'.iR<(RR(RRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytvoidresp�scCsmdt}|jdkr.dG|j|�GHn|jj|t�|j�}|d d	krit|�ndS(
s�Abort a file transfer.  Uses out-of-band data.
        This does not follow the procedure from the RFC to send Telnet
        IP and Synch; that doesn't seem to work with the servers I've
        tried.  Instead, just send the ABOR command as OOB data.tABORis*put urgent*it426t225t226N(RERFRG(R.R R!RR/tMSG_OOBR:R
(RR0RA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytabort�s
cCs|j|�|j�S(s'Send a command and return the response.(R2R(Rtcmd((s+/opt/alt/python27/lib64/python2.7/ftplib.pytsendcmd�s
cCs|j|�|j�S(s8Send a command and expect a response beginning with '2'.(R2RC(RRJ((s+/opt/alt/python27/lib64/python2.7/ftplib.pytvoidcmd�s
cCsY|jd�}t|d�t|d�g}||}ddj|�}|j|�S(sUSend a PORT command with the current host and the given
        port number.
        t.isPORT t,(tsplitR*tjoinRL(RRRthbytestpbytestbytesRJ((s+/opt/alt/python27/lib64/python2.7/ftplib.pytsendports
 
cCs�d}|jtjkr!d}n|jtjkr<d}n|dkrTtd�ndt|�|t|�dg}ddj|�}|j|�S(sESend an EPRT command with the current host and the given port number.iiisunsupported address familyRsEPRT t|(RRtAF_INETtAF_INET6R
R*RPRL(RRRRtfieldsRJ((s+/opt/alt/python27/lib64/python2.7/ftplib.pytsendeprts		!cCsqd}d}x�tjdd|jtjdtj�D]w}|\}}}}}y&tj|||�}|j|�Wn2tjk
r�}|r�|j�nd}q4nXPq4W|dkr�|dk	r�|�q�tjd��n|j	d�|j
�d}	|jj
�d}
|jtjkr9|j
|
|	�}n|j|
|	�}|jtk	rm|j|j�n|S(s3Create a new socket and send a PORT command for it.is!getaddrinfo returns an empty listiN(tNoneRtgetaddrinfoRtSOCK_STREAMt
AI_PASSIVEtbindterrortclosetlistentgetsocknameRRVRTRYRRt
settimeout(RterrRtresRtsocktypetprotot	canonnametsaRRRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytmakeports4.
	
cCsa|jtjkr0t|jd��\}}n't|jd�|jj��\}}||fS(NtPASVtEPSV(RRRVtparse227RKtparse229Rtgetpeername(RRR((s+/opt/alt/python27/lib64/python2.7/ftplib.pytmakepasv8s'c
Cs�d}|jr�|j�\}}tj||f|j�}yn|dk	r_|jd|�n|j|�}|ddkr�|j�}n|ddkr�t|�nWq�|j	��q�Xn�|j
�}z�|dk	r�|jd|�n|j|�}|ddkr!|j�}n|ddkr=t|�n|j�\}}	|jtk	rq|j
|j�nWd|j	�X|d dkr�t|�}n||fS(s�Initiate a transfer over the data connection.

        If the transfer is active, send a port command and the
        transfer command, and accept the connection.  If the server is
        passive, send a pasv command, connect to it, and start the
        transfer command.  Either way, return the socket for the
        connection and the expected size of the transfer.  The
        expected size may be None if it could not be determined.

        Optional `rest' argument can be a string that is sent as the
        argument to a REST command.  This is essentially a server
        marker used to tell the server to skip over any data up to the
        given marker.
        sREST %siR<R;Nit150(RZR%RpRRRRKRRR`RjtacceptRRctparse150(
RRJtresttsizeRRtconnRARtsockaddr((s+/opt/alt/python27/lib64/python2.7/ftplib.pytntransfercmd?s>	

cCs|j||�dS(s0Like ntransfercmd() but returns only the socket.i(Rx(RRJRt((s+/opt/alt/python27/lib64/python2.7/ftplib.pyttransfercmdxscCs�|sd}n|sd}n|s-d}n|dkrR|dkrR|d}n|jd|�}|ddkr�|jd|�}n|ddkr�|jd	|�}n|dd
kr�t|�n|S(sLogin, default anonymous.t	anonymousRR7s
anonymous@sUSER iR=sPASS sACCT R<(RR7(RKR(RRRRRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR|s 			
i cCse|jd�|j||�}z.x'|j|�}|s>Pn||�q%WWd|j�X|j�S(s�Retrieve data in binary mode.  A new port is created for you.

        Args:
          cmd: A RETR command.
          callback: A single parameter callable to be called on each
                    block of data read.
          blocksize: The maximum number of bytes to read from the
                     socket at one time.  [default: 8192]
          rest: Passed to transfercmd().  [default: None]

        Returns:
          The response code.
        sTYPE IN(RLRytrecvR`RC(RRJtcallbackt	blocksizeRtRvtdata((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt
retrbinary�s
cCs.|d
krt}n|jd�}|j|�}d
}z�|jd�}x�|j|jd�}t|�|jkr�td|j��n|j	dkr�dGt
|�GHn|s�Pn|dtkr�|d }n|dd	kr�|d }n||�qNWWd
|r|j�n|j�X|j
�S(snRetrieve data in line mode.  A new port is created for you.

        Args:
          cmd: A RETR, LIST, NLST, or MLSD command.
          callback: An optional single parameter callable that is called
                    for each line with the trailing CRLF stripped.
                    [default: print_line()]

        Returns:
          The response code.
        sTYPE ARisgot more than %d bytesis*retr*i����i����s
N(RZt
print_lineRKRyRR3R4R)RR R*R.R`RC(RRJR|RARvtfpR0((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt	retrlines�s0	


cCs{|jd�|j||�}zDx=|j|�}|s>Pn|j|�|r%||�q%q%WWd|j�X|j�S(s9Store a file in binary mode.  A new port is created for you.

        Args:
          cmd: A STOR command.
          fp: A file-like object with a read(num_bytes) method.
          blocksize: The maximum data size to read from fp and send over
                     the connection at once.  [default: 8192]
          callback: An optional single parameter callable that is called on
                    each block of data after it is sent.  [default: None]
          rest: Passed to transfercmd().  [default: None]

        Returns:
          The response code.
        sTYPE IN(RLRytreadR/R`RC(RRJR�R}R|RtRvtbuf((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt
storbinary�s

cCs�|jd�|j|�}z�x�|j|jd�}t|�|jkrctd|j��n|smPn|dtkr�|dtkr�|d }n|t}n|j|�|r"||�q"q"WWd|j�X|j	�S(shStore a file in line mode.  A new port is created for you.

        Args:
          cmd: A STOR command.
          fp: A file-like object with a readline() method.
          callback: An optional single parameter callable that is called on
                    each line after it is sent.  [default: None]

        Returns:
          The response code.
        sTYPE Aisgot more than %d bytesi����i����N(
RLRyR3R4R)RR.R/R`RC(RRJR�R|RvR�((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt	storlines�s$



cCsd|}|j|�S(sSend new account name.sACCT (RL(RtpasswordRJ((s+/opt/alt/python27/lib64/python2.7/ftplib.pyRs
cGsBd}x|D]}|d|}q
Wg}|j||j�|S(sBReturn a list of files in a given directory (default the current).tNLSTt (R�tappend(RtargsRJtargtfiles((s+/opt/alt/python27/lib64/python2.7/ftplib.pytnlsts
cGs�d}d}|drJt|d�td�krJ|d |d}}nx%|D]}|rQ|d|}qQqQW|j||�dS(sList a directory in long form.
        By default list current directory to stdout.
        Optional last argument is callback function; all
        non-empty arguments before it are concatenated to the
        LIST command.  (This *should* only be used for a pathname.)tLISTi����RR�N(RZttypeR�(RR�RJtfuncR�((s+/opt/alt/python27/lib64/python2.7/ftplib.pytdirs&
cCs@|jd|�}|ddkr/t|�n|jd|�S(sRename a file.sRNFR iR=sRNTO (RKRRL(RtfromnamettonameRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytrename$scCs4|jd|�}|d dkr'|St|�dS(sDelete a file.sDELE it250t200N(R�R�(RKR(RtfilenameRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytdelete+scCs|dkrSy|jd�SWqhtk
rO}|jdd dkrP�qPqhXn|dkrhd}nd|}|j|�S(	sChange to a directory.s..tCDUPiit500RRMsCWD (RLR	R�(RtdirnametmsgRJ((s+/opt/alt/python27/lib64/python2.7/ftplib.pytcwd3s
	
cCsi|jd|�}|d dkre|dj�}yt|�SWqettfk
rat|�SXndS(sRetrieve the size of a file.sSIZE it213N(RKtstriptintt
OverflowErrorR-tlong(RR�RAR+((s+/opt/alt/python27/lib64/python2.7/ftplib.pyRu@scCs|jd|�}t|�S(s+Make a directory, return its full pathname.sMKD (RKtparse257(RR�RA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytmkdKscCs|jd|�S(sRemove a directory.sRMD (RL(RR�((s+/opt/alt/python27/lib64/python2.7/ftplib.pytrmdPscCs|jd�}t|�S(s!Return current working directory.tPWD(RKR�(RRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytpwdTscCs|jd�}|j�|S(sQuit, and close the connection.tQUIT(RLR`(RRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytquitYs
cCsbz/|j}d|_|dk	r.|j�nWd|j}d|_|dk	r]|j�nXdS(s8Close the connection without assuming anything about it.N(RRZR`R(RRR((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR`_s				N(6RRt__doc__R RtFTP_PORTRtMAXLINER4RZRRRR%RRR
R"R$tdebugR'R!R1R2R6R:RRCRIRKRLRTRYRjRpRxRyRRR�R�R�RR�R�R�R�R�RuR�R�R�R�R`(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyROsb										
					
	
		9$							
					tFTP_TLSc
Bs�eZdZejZddddd
d
d
ed
d�	Zddde	d�Z
d�Zd�Zd�Z
d
d�Zdd
d	�Zd
d
�Zdd
d
d�Zd
d�ZRS(s�A FTP subclass which adds TLS support to FTP as described
        in RFC-4217.

        Connect as usual to port 21 implicitly securing the FTP control
        connection before authenticating.

        Securing the data connection requires user to explicitly ask
        for it by calling prot_p() method.

        Usage example:
        >>> from ftplib import FTP_TLS
        >>> ftps = FTP_TLS('ftp.python.org')
        >>> ftps.login()  # login anonymously previously securing control channel
        '230 Guest login ok, access restrictions apply.'
        >>> ftps.prot_p()  # switch to secure data connection
        '200 Protection level set to P'
        >>> ftps.retrlines('LIST')  # list directory content securely
        total 9
        drwxr-xr-x   8 root     wheel        1024 Jan  3  1994 .
        drwxr-xr-x   8 root     wheel        1024 Jan  3  1994 ..
        drwxr-xr-x   2 root     wheel        1024 Jan  3  1994 bin
        drwxr-xr-x   2 root     wheel        1024 Jan  3  1994 etc
        d-wxrwxr-x   2 ftp      wheel        1024 Sep  5 13:43 incoming
        drwxr-xr-x   2 root     wheel        1024 Nov 17  1993 lib
        drwxr-xr-x   6 1094     wheel        1024 Sep 13 19:07 pub
        drwxr-xr-x   3 root     wheel        1024 Jan  3  1994 usr
        -rw-r--r--   1 root     root          312 Aug  1  1994 welcome.msg
        '226 Transfer complete.'
        >>> ftps.quit()
        '221 Goodbye.'
        >>>
        Rc

Cs�|dk	r'|dk	r'td��n|dk	rN|dk	rNtd��n||_||_|dkr�tj|jd|d|�}n||_t|_	t
j||||||�dS(Ns4context and keyfile arguments are mutually exclusives5context and certfile arguments are mutually exclusivetcertfiletkeyfile(RZR-R�R�tsslt_create_stdlib_contexttssl_versiontcontexttFalset_prot_pRR(
RRRRRR�R�R�Rtsource_address((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�s				cCs?|r)t|jtj�r)|j�ntj||||�S(N(t
isinstanceRR�t	SSLSockettauthRR(RRRRtsecure((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�s
cCs�t|jtj�r$td��n|jtjkrH|jd�}n|jd�}|jj	|jd|j
�|_|jjdd�|_|S(s2Set up secure control connection by using TLS/SSL.sAlready using TLSsAUTH TLSsAUTH SSLtserver_hostnametmodeR(
R�RR�R�R-R�tPROTOCOL_SSLv23RLR�twrap_socketRRR(RRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR��scCs)|jd�|jd�}t|_|S(sSet up secure data connection.sPBSZ 0sPROT P(RLtTrueR�(RRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytprot_p�s
	cCs|jd�}t|_|S(s"Set up clear text data connection.sPROT C(RLR�R�(RRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pytprot_c�s	cCsLtj|||�\}}|jrB|jj|d|j�}n||fS(NR�(RRxR�R�R�R(RRJRtRvRu((s+/opt/alt/python27/lib64/python2.7/ftplib.pyRx�s
	i cCs�|jd�|j||�}zMx'|j|�}|s>Pn||�q%Wt|tj�rk|j�nWd|j�X|j�S(NsTYPE I(	RLRyR{R�R�R�tunwrapR`RC(RRJR|R}RtRvR~((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�s
cCs>|dkrt}n|jd�}|j|�}|jd�}z�x�|j|jd�}t|�|jkr�td|j��n|j	dkr�dGt
|�GHn|s�Pn|dtkr�|d }n|dd	kr�|d }n||�qHWt|t
j�r|j�nWd|j�|j�X|j�S(
NsTYPE ARisgot more than %d bytesis*retr*i����i����s
(RZR�RKRyRR3R4R)RR R*R.R�R�R�R�R`RC(RRJR|RARvR�R0((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR��s0	


cCs�|jd�|j||�}zcx=|j|�}|s>Pn|j|�|r%||�q%q%Wt|tj�r�|j�nWd|j�X|j	�S(NsTYPE I(
RLRyR�R/R�R�R�R�R`RC(RRJR�R}R|RtRvR�((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�s

cCs|jd�|j|�}z�x�|j|jd�}t|�|jkrctd|j��n|smPn|dtkr�|dtkr�|d }n|t}n|j|�|r"||�q"q"Wt|t	j
�r�|j�nWd|j�X|j
�S(NsTYPE Aisgot more than %d bytesi����i����(RLRyR3R4R)RR.R/R�R�R�R�R`RC(RRJR�R|RvR�((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�s(



N(RRR�R�R�R�RZRRR�RR�R�R�RxRR�R�R�(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�qs 		
		cCs�|d dkrt|�ntdkrLddl}|jd|j�antj|�}|sedS|jd�}yt|�SWnt	t
fk
r�t|�SXdS(s�Parse the '150' response for a RETR request.
    Returns the expected transfer size or None; size is not guaranteed to
    be present in the 150 message.
    iRqi����Ns150 .* \((\d+) bytes\)i(Rt_150_reRZtretcompilet
IGNORECASEtmatchtgroupR�R�R-R�(RAR�tmR+((s+/opt/alt/python27/lib64/python2.7/ftplib.pyRs-scCs�|d dkrt|�ntdkrFddl}|jd�antj|�}|sgt|�n|j�}dj|d �}t	|d�d>t	|d	�}||fS(
s�Parse the '227' response for a PASV request.
    Raises error_proto if it does not contain '(h1,h2,h3,h4,p1,p2)'
    Return ('host.addr.as.numbers', port#) tuple.it227i����Ns#(\d+),(\d+),(\d+),(\d+),(\d+),(\d+)RMiii(
Rt_227_reRZR�R�tsearchR
tgroupsRPR�(RAR�R�tnumbersRR((s+/opt/alt/python27/lib64/python2.7/ftplib.pyRmDs"cCs�|d dkrt|�n|jd�}|dkrCt|�n|jd|d�}|dkrqt|�n||d||dkr�t|�n||d|!j||d�}t|�dkr�t|�n|d}t|d�}||fS(s�Parse the '229' response for an EPSV request.
    Raises error_proto if it does not contain '(|||port|)'
    Return ('host.addr.as.numbers', port#) tuple.it229t(it)ii(RtfindR
ROR)R�(RAtpeertlefttrighttpartsRR((s+/opt/alt/python27/lib64/python2.7/ftplib.pyRnXs "
cCs�|d dkrt|�n|dd!dkr3dSd}d}t|�}xg||kr�||}|d}|dkr�||ks�||dkr�Pn|d}n||}qNW|S(s�Parse the '257' response for a MKD or PWD request.
    This is a response to a MKD or PWD request: a directory name.
    Returns the directoryname in the 257 reply.it257is "Rit"(RR)(RAR�R,tnRB((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�ns 


cCs	|GHdS(s+Default retrlines callback to print a line.N((R0((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR��sRtIc	Cs�|s|}nd|}|j|�|j|�t|jd��\}}|j||�|jd|�}|d d	kr�t�n|jd|�}|d d
kr�t�n|j�|j�dS(s+Copy file from one FTP-instance to another.sTYPE RksSTOR it125RqsRETR N(R�Rq(R�Rq(RLRmRKRTR
RC(	tsourcet
sourcenamettargett
targetnameR�t
sourcehostt
sourceportttreplytsreply((s+/opt/alt/python27/lib64/python2.7/ftplib.pytftpcp�s	


		
cBsPeZdZdZdZdZdd�Zd�Zd�Z	d�Z
d�ZRS(s�Class to parse & provide access to 'netrc' format files.

    See the netrc(4) man page for information on the file format.

    WARNING: This class is obsolete -- use module netrc instead.

    cCs|dkrFdtjkr:tjjtjdd�}qFtd�ni|_i|_t|d�}d}x�|j	|j
d�}t|�|j
kr�td|j
��n|s�Pn|r�|j
�r�|j|�qpn"|rt|�|j|<d}n|j�}d}}	}
}d}d}
x.|
t|�kr\||
}|
dt|�krr||
d}nd}|dkr�d}n�|d	kr�|r�|j�}|
d}
n�|d
kr�|r�|}	|
d}
nr|dkr|r|}
|
d}
nM|dkr'|r'|}|
d}
n(|d
krO|rO|}g}d}Pn|
d}
q/W|r�|	po|j|_|
p�|j|_|p�|j|_n|rp||jkr�|j|\}}}|	p�|}	|
p�|}
|p�|}n|	|
|f|j|<qpqpW|j�dS(NtHOMEs.netrcs!specify file to load or set $HOMEtriisgot more than %d bytestdefaulttmachineRR�taccounttmacdef(RZtostenvirontpathRPtIOErrort
_Netrc__hostst_Netrc__macrostopenR3R4R)RR�R�ttupleROtlowert_Netrc__defusert_Netrc__defpasswdt_Netrc__defacctR`(RR�R�tin_macroR0tmacro_linest
macro_nametwordsRRRRR�R,tw1tw2tousertopasswdtoacct((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�s~			
	
	



cCs
|jj�S(s4Return a list of hosts mentioned in the .netrc file.(R�tkeys(R((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt	get_hosts�scCs||j�}d}}}||jkrB|j|\}}}n|pN|j}|p]|j}|pl|j}|||fS(s�Returns login information for the named host.

        The return value is a triple containing userid,
        password, and the accounting field.

        N(R�RZR�R�R�R�(RRRRR((s+/opt/alt/python27/lib64/python2.7/ftplib.pytget_account�scCs
|jj�S(s)Return a list of all defined macro names.(R�R(R((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt
get_macrosscCs|j|S(s6Return a sequence of lines which define a named macro.(R�(Rtmacro((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt	get_macrosN(RRR�RZR�R�R�RRRRR(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR�sC			cCs4ttj�dkr-tjGHtjd�nd}d}x+tjddkrf|d}tjd=q<Wtjdd dkr�tjdd}tjd=ntjd}t|�}|j|�d}}}yt	|�}Wn0t
k
r|dk	rStjjd�qSnAXy|j
|�\}}}Wn!tk
rRtjjd�nX|j|||�x�tjdD]�}|d d	kr�|j|d�qt|d dkr�d
}	|dr�|	d|d}	n|j|	�}
qt|dkr|j|j�qt|jd
|tjjd�qtW|j�dS(s�Test program.
    Usage: ftp [-d] [-r[file]] host [-l[dir]] [-d[dir]] [-p] [file] ...

    -d dir
    -l list
    -p password
    iiis-ds-rRs5Could not open account file -- using anonymous login.s$No account -- using anonymous login.s-ltCWDR�s-psRETR iN(R)tsystargvttestR�texitRZRR$RR�tstderrtwriteRtKeyErrorRR�RKR'R%RtstdoutR�(R trcfileRtftptuseridRRtnetrcRRJRA((s+/opt/alt/python27/lib64/python2.7/ftplib.pyR
sN	





	

t__main__('R�R�R	tSOCKSRRtImportErrorRt__all__RHR�R�t	ExceptionRRRR	R
R�R5t
all_errorsR.RR�R�R�tSSLErrorRZR�RsR�RmRnR�R�R�RRR(((s+/opt/alt/python27/lib64/python2.7/ftplib.pyt<module>sZ
	
��
�
					m	7

SILENT KILLER Tool