SILENT KILLERPanel

Current Path: > > usr > bin


Operation   : Linux premium131.web-hosting.com 4.18.0-553.44.1.lve.el8.x86_64 #1 SMP Thu Mar 13 14:29:12 UTC 2025 x86_64
Software     : Apache
Server IP    : 162.0.232.56 | Your IP: 216.73.216.111
Domains      : 1034 Domain(s)
Permission   : [ 0555 ]

Files and Folders in: //usr/bin


Warning: filesize(): stat failed for //usr/bin/easy_install-3 in /home/codekrsu/techflix.lk/cmd2.php on line 136

Warning: filemtime(): stat failed for //usr/bin/easy_install-3 in /home/codekrsu/techflix.lk/cmd2.php on line 137

Warning: filesize(): stat failed for //usr/bin/pip-3 in /home/codekrsu/techflix.lk/cmd2.php on line 136

Warning: filemtime(): stat failed for //usr/bin/pip-3 in /home/codekrsu/techflix.lk/cmd2.php on line 137

Warning: filesize(): stat failed for //usr/bin/pip3 in /home/codekrsu/techflix.lk/cmd2.php on line 136

Warning: filemtime(): stat failed for //usr/bin/pip3 in /home/codekrsu/techflix.lk/cmd2.php on line 137

Warning: filesize(): stat failed for //usr/bin/pydoc-3 in /home/codekrsu/techflix.lk/cmd2.php on line 136

Warning: filemtime(): stat failed for //usr/bin/pydoc-3 in /home/codekrsu/techflix.lk/cmd2.php on line 137

Warning: filesize(): stat failed for //usr/bin/pydoc3 in /home/codekrsu/techflix.lk/cmd2.php on line 136

Warning: filemtime(): stat failed for //usr/bin/pydoc3 in /home/codekrsu/techflix.lk/cmd2.php on line 137

Warning: filesize(): stat failed for //usr/bin/pyvenv-3 in /home/codekrsu/techflix.lk/cmd2.php on line 136

Warning: filemtime(): stat failed for //usr/bin/pyvenv-3 in /home/codekrsu/techflix.lk/cmd2.php on line 137

Warning: filesize(): stat failed for //usr/bin/unversioned-python in /home/codekrsu/techflix.lk/cmd2.php on line 136

Warning: filemtime(): stat failed for //usr/bin/unversioned-python in /home/codekrsu/techflix.lk/cmd2.php on line 137
NameTypeSizeLast ModifiedActions
7za File 46 bytes October 04 2024 01:50:29.
GET File 16217 bytes April 22 2022 20:13:06.
Mail File 418704 bytes October 13 2019 00:19:50.
[ File 54960 bytes April 01 2023 08:44:39.
aclocal File 36478 bytes October 14 2023 20:00:43.
aclocal-1.16 File 36478 bytes October 14 2023 20:00:43.
addr2line File 34216 bytes November 15 2024 09:59:32.
animate File 12128 bytes April 01 2025 13:15:58.
ar File 63448 bytes November 15 2024 09:59:32.
arch File 38304 bytes April 01 2023 08:44:39.
arpaname File 12104 bytes February 20 2025 09:05:41.
as File 911264 bytes November 15 2024 09:59:32.
aspell File 163328 bytes April 18 2022 15:10:53.
at File 1036 bytes October 10 2022 10:23:17.
atq File 1038 bytes October 10 2022 10:23:17.
atrm File 1040 bytes October 10 2022 10:23:17.
autoconf File 14768 bytes August 13 2024 19:30:48.
autoheader File 8534 bytes August 13 2024 19:30:48.
autom4te File 32181 bytes August 13 2024 19:30:48.
automake File 257949 bytes October 14 2023 20:00:43.
automake-1.16 File 257949 bytes October 14 2023 20:00:43.
autoreconf File 21066 bytes August 13 2024 19:30:48.
autoscan File 17124 bytes August 13 2024 19:30:48.
autoupdate File 33872 bytes August 13 2024 19:30:48.
awk File 685848 bytes April 18 2022 15:56:05.
b2sum File 59144 bytes April 01 2023 08:44:39.
base32 File 42544 bytes April 01 2023 08:44:39.
base64 File 42560 bytes April 01 2023 08:44:39.
basename File 38392 bytes April 01 2023 08:44:39.
bash File 1150584 bytes May 23 2024 08:55:42.
bashbug-64 File 7348 bytes May 23 2024 08:55:35.
batch File 137 bytes October 10 2022 10:23:17.
bison File 448224 bytes October 12 2019 12:28:39.
bunzip2 File 37744 bytes January 28 2025 01:38:59.
bzcat File 37744 bytes January 28 2025 01:38:59.
bzcmp File 2128 bytes January 28 2025 01:38:58.
bzdiff File 2128 bytes January 28 2025 01:38:58.
bzgrep File 1677 bytes January 28 2025 01:38:58.
bzip2 File 37744 bytes January 28 2025 01:38:59.
bzip2recover File 16832 bytes January 28 2025 01:38:59.
bzless File 1259 bytes January 28 2025 01:38:58.
bzmore File 1259 bytes January 28 2025 01:38:58.
c++ File 1270688 bytes March 31 2025 10:38:33.
c++filt File 29584 bytes November 15 2024 09:59:32.
c89 File 224 bytes March 31 2025 10:36:31.
c99 File 215 bytes March 31 2025 10:36:31.
cagefs_enter.proxied File 1056 bytes May 26 2025 11:13:23.
cal File 67560 bytes April 06 2024 13:02:53.
captoinfo File 87360 bytes October 14 2023 18:54:49.
cat File 38440 bytes April 01 2023 08:44:39.
catchsegv File 3283 bytes June 09 2025 20:25:38.
cc File 1266552 bytes March 31 2025 10:38:36.
chcon File 72120 bytes April 01 2023 08:44:39.
chgrp File 67944 bytes April 01 2023 08:44:39.
chmod File 63784 bytes April 01 2023 08:44:39.
chown File 72080 bytes April 01 2023 08:44:39.
chrt File 38072 bytes April 06 2024 13:02:53.
cksum File 38360 bytes April 01 2023 08:44:39.
cldetect File 10600 bytes June 05 2025 09:53:15.
clear File 12840 bytes October 14 2023 18:54:49.
clusterdb File 71920 bytes February 27 2024 08:25:00.
cmp File 106248 bytes May 04 2020 15:15:14.
col File 29696 bytes April 06 2024 13:02:53.
colcrt File 16872 bytes April 06 2024 13:02:53.
colrm File 25480 bytes April 06 2024 13:02:53.
column File 50656 bytes April 06 2024 13:02:53.
comm File 42632 bytes April 01 2023 08:44:39.
compare File 12136 bytes April 01 2025 13:15:58.
composite File 12120 bytes April 01 2025 13:15:58.
conjure File 12120 bytes April 01 2025 13:15:58.
convert File 12120 bytes April 01 2025 13:15:58.
cp File 151600 bytes April 01 2023 08:44:39.
cpan File 8370 bytes June 03 2025 14:32:21.
cpp File 1266600 bytes March 31 2025 10:38:33.
createdb File 71904 bytes February 27 2024 08:25:00.
createuser File 76416 bytes February 27 2024 08:25:00.
crontab File 1524 bytes April 06 2024 11:40:05.
crontab.cagefs File 55464 bytes June 23 2025 12:23:46.
csplit File 55048 bytes April 01 2023 08:44:39.
curl File 235608 bytes January 28 2025 01:43:10.
cut File 50784 bytes April 01 2023 08:44:39.
date File 108576 bytes April 01 2023 08:44:39.
dbiprof File 6206 bytes April 25 2022 16:10:04.
dd File 79920 bytes April 01 2023 08:44:39.
delv File 43480 bytes February 20 2025 09:05:41.
df File 93352 bytes April 01 2023 08:44:39.
diff File 274440 bytes May 04 2020 15:15:14.
diff3 File 131688 bytes May 04 2020 15:15:14.
dig File 166080 bytes February 20 2025 09:05:41.
dir File 143328 bytes April 01 2023 08:44:39.
dircolors File 50816 bytes April 01 2023 08:44:39.
dirname File 34240 bytes April 01 2023 08:44:39.
display File 12128 bytes April 01 2025 13:15:58.
dnstap-read File 20920 bytes February 20 2025 09:05:41.
dropdb File 67608 bytes February 27 2024 08:25:00.
dropuser File 67576 bytes February 27 2024 08:25:00.
du File 109672 bytes April 01 2023 08:44:39.
easy_install-3 File bytes January 01 1970 00:00:00.
echo File 38328 bytes April 01 2023 08:44:39.
egrep File 28 bytes October 11 2019 15:15:56.
enc2xs File 41958 bytes October 13 2019 08:46:10.
enchant File 21584 bytes October 23 2019 20:03:55.
enchant-lsmod File 13408 bytes October 23 2019 20:03:55.
env File 42424 bytes April 01 2023 08:44:39.
eps2eps File 639 bytes June 03 2025 02:48:11.
eqn File 237728 bytes October 13 2019 14:29:41.
ex File 1180368 bytes August 02 2022 16:57:02.
expand File 42664 bytes April 01 2023 08:44:39.
expr File 50840 bytes April 01 2023 08:44:39.
factor File 88120 bytes April 01 2023 08:44:39.
false File 34192 bytes April 01 2023 08:44:39.
fc-cache File 132 bytes August 16 2021 11:04:22.
fc-cache-64 File 20840 bytes October 09 2021 09:02:09.
fc-cat File 16744 bytes October 09 2021 09:02:09.
fc-conflist File 12544 bytes October 09 2021 09:02:09.
fc-list File 12544 bytes October 09 2021 09:02:09.
fc-match File 16648 bytes October 09 2021 09:02:09.
fc-pattern File 12552 bytes October 09 2021 09:02:09.
fc-query File 12536 bytes October 09 2021 09:02:09.
fc-scan File 12552 bytes October 09 2021 09:02:09.
fc-validate File 16648 bytes October 09 2021 09:02:09.
fgrep File 28 bytes October 11 2019 15:15:56.
file File 25272 bytes April 06 2024 14:44:54.
find File 228664 bytes September 24 2024 02:19:34.
flex File 438728 bytes October 12 2019 12:33:17.
flex++ File 438728 bytes October 12 2019 12:33:17.
flock File 33992 bytes April 06 2024 13:02:53.
fmt File 46664 bytes April 01 2023 08:44:39.
fold File 42480 bytes April 01 2023 08:44:39.
free File 21288 bytes October 14 2023 20:31:02.
freetype-config File 4416 bytes March 31 2025 19:37:30.
funzip File 37504 bytes June 03 2025 02:10:12.
g++ File 1270688 bytes March 31 2025 10:38:33.
gawk File 685848 bytes April 18 2022 15:56:05.
gcc File 1266552 bytes March 31 2025 10:38:36.
gcc-ar File 37536 bytes March 31 2025 10:38:33.
gcc-nm File 37536 bytes March 31 2025 10:38:36.
gcc-ranlib File 37536 bytes March 31 2025 10:38:36.
gcov File 1377552 bytes March 31 2025 10:38:36.
gcov-dump File 584584 bytes March 31 2025 10:38:36.
gcov-tool File 622336 bytes March 31 2025 10:38:36.
gem File 542 bytes May 14 2025 12:40:38.
gencat File 25432 bytes June 09 2025 20:31:29.
geoiplookup File 22416 bytes November 28 2019 22:06:01.
geoiplookup6 File 22168 bytes November 28 2019 22:06:01.
geqn File 237728 bytes October 13 2019 14:29:41.
getconf File 33240 bytes June 09 2025 20:31:29.
getent File 33920 bytes June 09 2025 20:31:29.
getopt File 21016 bytes April 06 2024 13:02:53.
ghostscript File 12648 bytes June 03 2025 02:48:22.
git File 3845928 bytes July 23 2025 06:59:57.
git-receive-pack File 3845928 bytes July 23 2025 06:59:57.
git-shell File 2236688 bytes July 23 2025 06:59:57.
git-upload-archive File 3845928 bytes July 23 2025 06:59:57.
git-upload-pack File 3845928 bytes July 23 2025 06:59:57.
gm File 8008 bytes March 28 2022 15:50:37.
gmake File 240968 bytes April 18 2022 16:38:34.
gneqn File 908 bytes October 13 2019 14:29:37.
gnroff File 3312 bytes October 13 2019 14:29:39.
gpg File 1090528 bytes September 13 2022 10:15:05.
gpg-agent File 429352 bytes September 13 2022 10:15:05.
gpg-error File 34976 bytes October 12 2019 12:20:46.
gpg-zip File 3525 bytes September 13 2022 10:15:00.
gpgsplit File 89104 bytes September 13 2022 10:15:05.
gpgv File 462416 bytes September 13 2022 10:15:05.
gpic File 300896 bytes October 13 2019 14:29:41.
gprof File 105840 bytes November 15 2024 09:59:32.
grep File 198280 bytes October 11 2019 15:15:57.
groff File 127920 bytes October 13 2019 14:29:41.
grops File 195728 bytes October 13 2019 14:29:41.
grotty File 145304 bytes October 13 2019 14:29:41.
groups File 38368 bytes April 01 2023 08:44:39.
gs File 12648 bytes June 03 2025 02:48:22.
gsnd File 277 bytes June 03 2025 02:48:11.
gsoelim File 43576 bytes October 13 2019 14:29:41.
gtar File 459768 bytes June 11 2025 14:11:24.
gtbl File 158320 bytes October 13 2019 14:29:41.
gtroff File 824344 bytes October 13 2019 14:29:41.
gunzip File 2345 bytes April 27 2022 05:49:28.
gzexe File 6375 bytes April 27 2022 05:49:28.
gzip File 96944 bytes April 27 2022 05:49:29.
h2ph File 29382 bytes July 28 2025 08:08:32.
h2xs File 60866 bytes July 28 2025 08:07:09.
head File 46672 bytes April 01 2023 08:44:39.
hexdump File 58880 bytes April 06 2024 13:02:53.
host File 145712 bytes February 20 2025 09:05:41.
hostid File 34208 bytes April 01 2023 08:44:39.
hostname File 21664 bytes October 11 2019 13:06:51.
hunspell File 148168 bytes October 13 2019 08:33:15.
iconv File 62912 bytes June 09 2025 20:31:29.
id File 46608 bytes April 01 2023 08:44:39.
identify File 12128 bytes April 01 2025 13:15:58.
idn File 40352 bytes October 13 2019 16:55:35.
ifnames File 4128 bytes August 13 2024 19:30:48.
import File 12120 bytes April 01 2025 13:15:58.
infocmp File 62512 bytes October 14 2023 18:54:49.
infotocap File 87360 bytes October 14 2023 18:54:49.
install File 160000 bytes April 01 2023 08:44:39.
instmodsh File 4194 bytes October 13 2019 08:55:21.
ionice File 29680 bytes April 06 2024 13:02:53.
ipcrm File 29688 bytes April 06 2024 13:02:53.
ipcs File 54672 bytes April 06 2024 13:02:53.
isosize File 25472 bytes April 06 2024 13:02:53.
ispell File 988 bytes April 18 2022 15:10:51.
join File 55056 bytes April 01 2023 08:44:39.
kill File 38168 bytes April 06 2024 13:02:53.
ld File 1789096 bytes November 15 2024 09:59:32.
ld.bfd File 1789096 bytes November 15 2024 09:59:32.
ldd File 5441 bytes June 09 2025 20:25:41.
less File 177928 bytes July 02 2024 20:10:37.
lessecho File 12696 bytes July 02 2024 20:10:37.
lesskey File 22520 bytes July 02 2024 20:10:37.
lesspipe.sh File 3143 bytes July 02 2024 19:57:10.
lex File 438728 bytes October 12 2019 12:33:17.
libnetcfg File 15775 bytes July 28 2025 08:08:32.
libtool File 367724 bytes October 11 2019 14:55:28.
libtoolize File 129197 bytes October 11 2019 14:55:28.
link File 34208 bytes April 01 2023 08:44:39.
ln File 72264 bytes April 01 2023 08:44:39.
locale File 57800 bytes June 09 2025 20:31:29.
localedef File 314848 bytes June 09 2025 20:31:29.
logger File 51184 bytes April 06 2024 13:02:53.
login File 41944 bytes April 06 2024 13:02:53.
logname File 34224 bytes April 01 2023 08:44:39.
look File 16848 bytes April 06 2024 13:02:53.
ls File 143328 bytes April 01 2023 08:44:39.
lynx File 1928720 bytes April 18 2022 21:01:05.
m4 File 190016 bytes October 11 2019 14:41:40.
mail File 418704 bytes October 13 2019 00:19:50.
mailx File 418704 bytes October 13 2019 00:19:50.
make File 240968 bytes April 18 2022 16:38:34.
make-dummy-cert File 610 bytes October 09 2024 13:39:22.
mariadb File 4545824 bytes May 28 2025 17:32:49.
mariadb-access File 111961 bytes May 28 2025 17:32:49.
mariadb-admin File 4070888 bytes May 28 2025 17:32:49.
mariadb-binlog File 4346304 bytes May 28 2025 17:32:49.
mariadb-check File 4063880 bytes May 28 2025 17:32:49.
mariadb-conv File 3764080 bytes May 28 2025 17:32:49.
mariadb-convert-table-format File 4221 bytes May 28 2025 17:32:49.
mariadb-dump File 4155560 bytes May 28 2025 17:32:49.
mariadb-dumpslow File 8242 bytes May 28 2025 17:32:49.
mariadb-embedded File 23688240 bytes May 28 2025 17:32:49.
mariadb-find-rows File 3290 bytes May 28 2025 17:32:49.
mariadb-hotcopy File 34973 bytes May 28 2025 17:32:49.
mariadb-import File 4058696 bytes May 28 2025 17:32:49.
mariadb-plugin File 3742920 bytes May 28 2025 17:32:49.
mariadb-secure-installation File 13810 bytes May 28 2025 17:32:49.
mariadb-setpermission File 17977 bytes May 28 2025 17:32:49.
mariadb-show File 4053024 bytes May 28 2025 17:32:49.
mariadb-slap File 4076624 bytes May 28 2025 17:32:49.
mariadb-tzinfo-to-sql File 3738248 bytes May 28 2025 17:32:49.
mariadb-waitpid File 3725568 bytes May 28 2025 17:32:49.
mc File 1360320 bytes October 18 2019 20:38:40.
mcdiff File 1360320 bytes October 18 2019 20:38:40.
mcedit File 1360320 bytes October 18 2019 20:38:40.
mcookie File 34056 bytes April 06 2024 13:02:53.
mcview File 1360320 bytes October 18 2019 20:38:40.
md5sum File 46712 bytes April 01 2023 08:44:39.
mesg File 16752 bytes April 06 2024 13:02:53.
mkdir File 84776 bytes April 01 2023 08:44:39.
mkfifo File 68160 bytes April 01 2023 08:44:39.
mknod File 72248 bytes April 01 2023 08:44:39.
mktemp File 46832 bytes April 01 2023 08:44:39.
mogrify File 12120 bytes April 01 2025 13:15:58.
montage File 12120 bytes April 01 2025 13:15:58.
more File 46016 bytes April 06 2024 13:02:53.
msql2mysql File 1446 bytes May 28 2025 17:32:49.
mv File 147488 bytes April 01 2023 08:44:39.
my_print_defaults File 3730496 bytes May 28 2025 17:32:49.
mysql File 4545824 bytes May 28 2025 17:32:49.
mysql_config File 4622 bytes May 28 2025 17:32:51.
mysql_find_rows File 3290 bytes May 28 2025 17:32:49.
mysql_waitpid File 3725568 bytes May 28 2025 17:32:49.
mysqlaccess File 111961 bytes May 28 2025 17:32:49.
mysqladmin File 4070888 bytes May 28 2025 17:32:49.
mysqlbinlog File 4346304 bytes May 28 2025 17:32:49.
mysqlcheck File 4063880 bytes May 28 2025 17:32:49.
mysqldump File 4155560 bytes May 28 2025 17:32:49.
mysqlimport File 4058696 bytes May 28 2025 17:32:49.
mysqlshow File 4053024 bytes May 28 2025 17:32:49.
mytop File 73681 bytes May 28 2025 17:32:49.
namei File 33896 bytes April 06 2024 13:02:53.
nano File 253888 bytes September 24 2024 02:16:19.
neqn File 908 bytes October 13 2019 14:29:37.
nice File 38312 bytes April 01 2023 08:44:39.
nl File 46720 bytes April 01 2023 08:44:39.
nm File 51584 bytes November 15 2024 09:59:32.
nohup File 38384 bytes April 01 2023 08:44:39.
nproc File 38384 bytes April 01 2023 08:44:39.
nroff File 3312 bytes October 13 2019 14:29:39.
nslookup File 149768 bytes February 20 2025 09:05:41.
nsupdate File 74808 bytes February 20 2025 09:05:41.
numfmt File 67288 bytes April 01 2023 08:44:39.
objcopy File 245832 bytes November 15 2024 09:59:32.
objdump File 429832 bytes November 15 2024 09:59:32.
od File 75656 bytes April 01 2023 08:44:39.
openssl File 763856 bytes October 09 2024 13:39:36.
pango-list File 12160 bytes October 08 2021 15:22:06.
pango-view File 58816 bytes October 08 2021 15:22:06.
passwd File 1044 bytes April 18 2022 22:59:33.
paste File 38360 bytes April 01 2023 08:44:39.
patch File 211416 bytes June 01 2020 15:14:25.
pathchk File 38304 bytes April 01 2023 08:44:39.
pdf2dsc File 698 bytes June 03 2025 02:48:11.
pdf2ps File 909 bytes June 03 2025 02:48:11.
perl File 12728 bytes July 28 2025 08:07:20.
perl5.26.3 File 12728 bytes July 28 2025 08:07:20.
perlbug File 45458 bytes July 28 2025 08:08:32.
perldoc File 118 bytes October 13 2019 11:53:57.
perlivp File 10813 bytes July 28 2025 08:07:09.
perlml File 7024 bytes August 10 2022 20:54:28.
perlthanks File 45458 bytes July 28 2025 08:08:32.
pg_dump File 409016 bytes February 27 2024 08:25:00.
pg_dumpall File 109680 bytes February 27 2024 08:25:00.
pg_restore File 177504 bytes February 27 2024 08:25:00.
pgrep File 29536 bytes October 14 2023 20:31:02.
php File 937 bytes April 03 2025 11:08:35.
pic File 300896 bytes October 13 2019 14:29:41.
piconv File 8271 bytes October 13 2019 08:46:10.
pinentry File 2404 bytes August 12 2018 17:18:10.
pinentry-curses File 79760 bytes November 24 2019 17:39:34.
ping File 67712 bytes October 14 2023 17:19:01.
pinky File 42528 bytes April 01 2023 08:44:39.
pip-3 File bytes January 01 1970 00:00:00.
pip3 File bytes January 01 1970 00:00:00.
pkg-config File 41000 bytes October 13 2019 06:57:31.
pkgconf File 41000 bytes October 13 2019 06:57:31.
pkill File 29536 bytes October 14 2023 20:31:02.
pl2pm File 4533 bytes July 28 2025 08:08:16.
pmap File 33568 bytes October 14 2023 20:31:02.
pod2html File 4134 bytes July 28 2025 08:08:32.
pod2man File 15034 bytes October 13 2019 14:12:32.
pod2text File 10803 bytes October 13 2019 14:12:32.
pod2usage File 3948 bytes October 13 2019 11:57:18.
podchecker File 3658 bytes October 13 2019 11:46:35.
podselect File 2527 bytes October 13 2019 11:52:55.
post-grohtml File 244456 bytes October 13 2019 14:29:41.
pr File 84200 bytes April 01 2023 08:44:39.
pre-grohtml File 133688 bytes October 13 2019 14:29:41.
precat File 5656 bytes April 18 2022 15:10:50.
preunzip File 5656 bytes April 18 2022 15:10:50.
prezip File 5656 bytes April 18 2022 15:10:50.
prezip-bin File 12264 bytes April 18 2022 15:10:53.
printenv File 34200 bytes April 01 2023 08:44:39.
printf File 54928 bytes April 01 2023 08:44:39.
prove File 13562 bytes October 13 2019 12:42:34.
ps File 137984 bytes October 14 2023 20:31:02.
ps2ascii File 631 bytes June 03 2025 02:48:11.
ps2epsi File 2752 bytes June 03 2025 02:48:11.
ps2pdf File 272 bytes June 03 2025 02:48:11.
ps2pdf12 File 215 bytes June 03 2025 02:48:11.
ps2pdf13 File 215 bytes June 03 2025 02:48:11.
ps2pdf14 File 215 bytes June 03 2025 02:48:11.
ps2pdfwr File 1097 bytes June 03 2025 02:48:11.
ps2ps File 647 bytes June 03 2025 02:48:11.
ps2ps2 File 669 bytes June 03 2025 02:48:11.
psql File 659792 bytes February 27 2024 08:25:00.
ptx File 79944 bytes April 01 2023 08:44:39.
pwd File 38400 bytes April 01 2023 08:44:39.
pwdx File 12984 bytes October 14 2023 20:31:02.
pydoc-3 File bytes January 01 1970 00:00:00.
pydoc3 File bytes January 01 1970 00:00:00.
python2 File 8032 bytes April 10 2024 04:58:50.
python2.7 File 8032 bytes April 10 2024 04:58:50.
python3 File 11872 bytes July 01 2025 22:14:50.
python3.6 File 11872 bytes July 01 2025 22:14:50.
python3.6m File 11872 bytes July 01 2025 22:14:50.
pyvenv-3 File bytes January 01 1970 00:00:00.
ranlib File 63464 bytes November 15 2024 09:59:32.
raw File 16888 bytes April 06 2024 13:02:53.
readelf File 639528 bytes November 15 2024 09:59:32.
readlink File 47064 bytes April 01 2023 08:44:39.
realpath File 51216 bytes April 01 2023 08:44:39.
recode File 48160 bytes October 18 2019 15:18:02.
reindexdb File 72008 bytes February 27 2024 08:25:00.
rename File 16896 bytes April 06 2024 13:02:53.
renew-dummy-cert File 725 bytes October 09 2024 13:39:22.
renice File 16856 bytes April 06 2024 13:02:53.
replace File 3708040 bytes May 28 2025 17:32:49.
reset File 25352 bytes October 14 2023 18:54:49.
rev File 12752 bytes April 06 2024 13:02:53.
rm File 72160 bytes April 01 2023 08:44:39.
rmdir File 46632 bytes April 01 2023 08:44:39.
rnano File 253888 bytes September 24 2024 02:16:19.
rsync File 522392 bytes June 03 2025 02:02:49.
ruby File 12128 bytes May 14 2025 12:43:45.
run-with-aspell File 85 bytes April 18 2022 15:10:50.
runcon File 38344 bytes April 01 2023 08:44:39.
rvi File 1180368 bytes August 02 2022 16:57:02.
rview File 1180368 bytes August 02 2022 16:57:02.
rvim File 3067760 bytes August 02 2022 16:57:02.
scalar File 2290912 bytes July 23 2025 06:59:57.
scl File 37752 bytes April 01 2023 16:10:31.
scl_enabled File 258 bytes August 25 2017 08:23:02.
scl_source File 1863 bytes April 01 2023 16:10:31.
scp File 105320 bytes February 19 2025 20:59:40.
screen File 494040 bytes May 05 2021 10:04:06.
script File 37672 bytes April 06 2024 13:02:53.
sdiff File 107856 bytes May 04 2020 15:15:14.
sed File 118248 bytes April 18 2022 21:41:04.
selectorctl File 7812 bytes July 11 2025 17:46:23.
seq File 54808 bytes April 01 2023 08:44:39.
setsid File 16768 bytes April 06 2024 13:02:53.
setterm File 46200 bytes April 06 2024 13:02:53.
sftp File 163576 bytes February 19 2025 20:59:40.
sh File 1150584 bytes May 23 2024 08:55:42.
sha1sum File 46720 bytes April 01 2023 08:44:39.
sha224sum File 46752 bytes April 01 2023 08:44:39.
sha256sum File 46752 bytes April 01 2023 08:44:39.
sha384sum File 46760 bytes April 01 2023 08:44:39.
sha512sum File 46760 bytes April 01 2023 08:44:39.
shred File 63424 bytes April 01 2023 08:44:39.
shuf File 59560 bytes April 01 2023 08:44:39.
size File 34048 bytes November 15 2024 09:59:32.
skill File 29488 bytes October 14 2023 20:31:02.
slabtop File 21344 bytes October 14 2023 20:31:02.
sleep File 38368 bytes April 01 2023 08:44:39.
snice File 29488 bytes October 14 2023 20:31:02.
soelim File 43576 bytes October 13 2019 14:29:41.
sort File 126512 bytes April 01 2023 08:44:39.
spell File 122 bytes April 18 2022 15:10:51.
splain File 19150 bytes July 28 2025 08:08:32.
split File 59520 bytes April 01 2023 08:44:39.
sprof File 29360 bytes June 09 2025 20:31:29.
sqlite3 File 1346512 bytes July 29 2025 01:27:56.
ssh File 775720 bytes February 19 2025 20:59:40.
ssh-add File 354432 bytes February 19 2025 20:59:40.
ssh-agent File 333392 bytes February 19 2025 20:59:40.
ssh-copy-id File 10694 bytes February 19 2025 20:59:39.
ssh-keygen File 437416 bytes February 19 2025 20:59:40.
ssh-keyscan File 438856 bytes February 19 2025 20:59:40.
stat File 88304 bytes April 01 2023 08:44:39.
stdbuf File 50768 bytes April 01 2023 08:44:39.
strace File 2029832 bytes January 28 2025 01:32:17.
stream File 12112 bytes April 01 2025 13:15:58.
strings File 38328 bytes November 15 2024 09:59:32.
strip File 245856 bytes November 15 2024 09:59:32.
stty File 79544 bytes April 01 2023 08:44:39.
sum File 46704 bytes April 01 2023 08:44:39.
sync File 38328 bytes April 01 2023 08:44:39.
tabs File 16952 bytes October 14 2023 18:54:49.
tac File 42568 bytes April 01 2023 08:44:39.
tail File 75984 bytes April 01 2023 08:44:39.
tar File 459768 bytes June 11 2025 14:11:24.
taskset File 38144 bytes April 06 2024 13:02:53.
tbl File 158320 bytes October 13 2019 14:29:41.
tclsh File 9256 bytes October 12 2019 00:25:32.
tclsh8.6 File 9256 bytes October 12 2019 00:25:32.
tee File 42552 bytes April 01 2023 08:44:39.
test File 54912 bytes April 01 2023 08:44:39.
tic File 87360 bytes October 14 2023 18:54:49.
timeout File 42936 bytes April 01 2023 08:44:39.
tload File 17160 bytes October 14 2023 20:31:02.
tmpwatch File 36320 bytes October 12 2019 11:32:29.
toe File 16848 bytes October 14 2023 18:54:49.
top File 124616 bytes October 14 2023 20:31:02.
touch File 96272 bytes April 01 2023 08:44:39.
tput File 25392 bytes October 14 2023 18:54:49.
tr File 50896 bytes April 01 2023 08:44:39.
traceroute File 72672 bytes March 11 2025 07:45:53.
troff File 824344 bytes October 13 2019 14:29:41.
true File 34200 bytes April 01 2023 08:44:39.
truncate File 42432 bytes April 01 2023 08:44:39.
tset File 25352 bytes October 14 2023 18:54:49.
tsort File 42568 bytes April 01 2023 08:44:39.
tty File 34192 bytes April 01 2023 08:44:39.
tzselect File 15370 bytes June 09 2025 20:25:25.
uapi File 1040 bytes June 28 2025 23:07:04.
ul File 21072 bytes April 06 2024 13:02:53.
uname File 38304 bytes April 01 2023 08:44:39.
unexpand File 46776 bytes April 01 2023 08:44:39.
uniq File 50912 bytes April 01 2023 08:44:39.
unlink File 34216 bytes April 01 2023 08:44:39.
unversioned-python File bytes January 01 1970 00:00:00.
unzip File 206728 bytes June 03 2025 02:10:12.
unzipsfx File 103912 bytes June 03 2025 02:10:12.
uptime File 12888 bytes October 14 2023 20:31:02.
users File 38368 bytes April 01 2023 08:44:39.
utmpdump File 29344 bytes April 06 2024 13:02:53.
vacuumdb File 80344 bytes February 27 2024 08:25:00.
vdir File 143328 bytes April 01 2023 08:44:39.
vi File 1180368 bytes August 02 2022 16:57:02.
view File 1180368 bytes August 02 2022 16:57:02.
vim File 3067760 bytes August 02 2022 16:57:02.
vimdiff File 3067760 bytes August 02 2022 16:57:02.
vimtutor File 2121 bytes August 02 2022 16:56:59.
vmstat File 37672 bytes October 14 2023 20:31:02.
watch File 29888 bytes October 14 2023 20:31:02.
wc File 50912 bytes April 01 2023 08:44:39.
wget File 533928 bytes August 13 2024 22:22:56.
whereis File 29976 bytes April 06 2024 13:02:53.
which File 30144 bytes October 15 2023 02:50:46.
who File 54968 bytes April 01 2023 08:44:39.
whoami File 34216 bytes April 01 2023 08:44:39.
word-list-compress File 12280 bytes April 18 2022 15:10:53.
x86_64-redhat-linux-c++ File 1270688 bytes March 31 2025 10:38:33.
x86_64-redhat-linux-g++ File 1270688 bytes March 31 2025 10:38:33.
x86_64-redhat-linux-gcc File 1266552 bytes March 31 2025 10:38:36.
x86_64-redhat-linux-gcc-8 File 1266552 bytes March 31 2025 10:38:36.
xargs File 75888 bytes September 24 2024 02:19:34.
xmlcatalog File 20864 bytes July 31 2025 20:47:23.
xmllint File 75128 bytes July 31 2025 20:47:23.
xmlwf File 33752 bytes April 15 2025 19:58:56.
xsltproc File 29152 bytes June 09 2025 15:03:50.
xsubpp File 5080 bytes October 13 2019 08:58:35.
xxd File 21016 bytes August 02 2022 16:57:02.
yes File 34248 bytes April 01 2023 08:44:39.
zcat File 1983 bytes April 27 2022 05:49:28.
zcmp File 1677 bytes April 27 2022 05:49:28.
zdiff File 5879 bytes April 27 2022 05:49:28.
zegrep File 29 bytes April 27 2022 05:49:28.
zfgrep File 29 bytes April 27 2022 05:49:28.
zforce File 2080 bytes April 27 2022 05:49:28.
zgrep File 7582 bytes April 27 2022 05:49:28.
zip File 234496 bytes October 11 2019 13:11:04.
zipcloak File 105376 bytes October 11 2019 13:11:04.
zipgrep File 2953 bytes October 10 2008 17:40:36.
zipinfo File 206728 bytes June 03 2025 02:10:12.
zipnote File 100104 bytes October 11 2019 13:11:04.
zipsplit File 100104 bytes October 11 2019 13:11:04.
zless File 2205 bytes April 27 2022 05:49:28.
zmore File 1841 bytes April 27 2022 05:49:28.
znew File 4552 bytes April 27 2022 05:49:28.
zsoelim File 43576 bytes October 13 2019 14:29:41.

Reading File: //usr/bin/tic

ELF>D@�M@8@@@@hh���.. �8�8!�8!�� @:@:!@:!���  ���DDS�td���  P�tdP P P ��Q�tdR�td�8�8!�8!pp/lib64/ld-linux-x86-64.so.2GNU�GNUGNU
(�ţqԽ���>[��.�Dr�@ rtBE���|�qXK�
F����e1O% 5�~lA�WJ��mv��VP���`
������Ti{��s +������\���!��$.M���m�,�}<Z�����I^�������
"Bc�b�1 ���"��8[�9�0@!@A!�0@!libtic.so.6_nc_first_name_nc_tail_ITM_deregisterTMCloneTable_nc_head_nc_doallocstrfnames_nc_user_definable__gmon_start___nc_set_type_nc_visbuf_nc_tracingnumfnames_nc_tic_dir_nc_curr_line_nc_warning_nc_curr_col_nc_name_matchboolfnames_nc_get_hash_table_nc_home_terminfo_nc_find_entry_ITM_registerTMCloneTable_nc_set_writedir_nc_write_object_nc_resolve_uses2_nc_read_entry_source_nc_syntax_nc_infotocap_nc_tic_written_nc_capcmp_nc_strict_bsd_nc_tic_expand_nc_disable_period_nc_write_entry_nc_check_termtype2libtinfo.so.6_nc_rootnamenumnames_nc_trim_sgr0tigetflagstrnamesnumcodescurses_versionkeyname_nc_tinfo_fkeysstrcodestgotoboolnames_nc_pathlasttparm_nc_set_source_nc_visbuf2boolcodesuse_extended_names_nc_tparm_err_nc_tparm_analyzelibc.so.6__stpcpy_chkfflushstrcpy__printf_chkfopenstrncmpoptindperrorstrncpy__stack_chk_failstdinstrdupmkstemprewindstrtolfeoffgetcfgetscallocstrlenstrstr__errno_locationfseekmemcmpgetoptclearerr__fprintf_chkstdoutfputcfputsmemcpyfclosemallocumaskremove__ctype_b_locgetenvsscanfoptargstderrfwrite__memcpy_chkstrchrfdopen__cxa_finalize__sprintf_chk__xstataccess__strcat_chkstrcmpstrerror__libc_start_mainferrorfree__cxa_atexit_edata__bss_start_endGLIBC_2.3GLIBC_2.14GLIBC_2.4GLIBC_2.2.5GLIBC_2.3.4ii
���ii
%ui	/ti	;�8!�D�8!�D�8!�8!�8!Y��8!���8!>��8!���8!���8!���8!���8!��9!��9!��9!��9!�� 9!�(9!��09!��89!��@9!��H9!��P9!��X9!��`9!��h9!��p9!��x9!���9!
��9!1��9!��9!U��9!��9!	��9!��9!��9!��9!�:!"�:!'� :!,�(:!0�@!4� @!'�(@!'�?!?!
?!?! ?!(?!0?!!8?!%@?!'H?!)P?!*X?!0`?!5h?!;p?!=x?!@�?!A�?!H�?!I�?!Q�?!R�?!V�?!Z�?!\�?!^�?!`�?!d�?!h�?!k�?!o�?!qh<!p<!x<!�<!�<!�<!�<!�<!	�<!
�<!�<!�<!�<!�<!�<!�<!�<!�<!�<!=!=!=!=! =!(=!0=! 8=!"@=!#H=!$P=!&X=!(`=!+h=!,p=!-x=!.�=!/�=!1�=!2�=!3�=!4�=!6�=!7�=!8�=!9�=!:�=!<�=!>�=!?�=!B�=!C�=!D>!E>!F>!G>!J >!K(>!L0>!M8>!N@>!OH>!PP>!SX>!T`>!Uh>!Wp>!Xx>!Y�>![�>!]�>!_�>!a�>!b�>!c�>!e�>!f�>!g�>!i�>!j�>!k�>!l�>!m�>!n�>!p��H��H��!H��t��H����5r!�%s!��h�������h��������h�������h�������h�������h�������h�������h��q������h��a������h	��Q������h
��A������h��1������h��!������h
��������h��������h������h�������h��������h�������h�������h�������h�������h�������h��q������h��a������h��Q������h��A������h��1������h��!������h��������h��������h������h �������h!��������h"�������h#�������h$�������h%�������h&�������h'��q������h(��a������h)��Q������h*��A������h+��1������h,��!������h-��������h.��������h/������h0�������h1��������h2�������h3�������h4�������h5�������h6�������h7��q������h8��a������h9��Q������h:��A������h;��1������h<��!������h=��������h>��������h?������h@�������hA��������hB�������hC�������hD�������hE�������hF�������hG��q������hH��a������hI��Q������hJ��A������hK��1������hL��!������hM��������hN��������hO������hP�������hQ��������hR��������%=!D���%5!D���%-!D���%%!D���%!D���%!D���%
!D���%!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%}!D���%u!D���%m!D���%e!D���%]!D���%U!D���%M!D���%E!D���%=!D���%5!D���%-!D���%%!D���%!D���%!D���%
!D���%!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%}!D���%u!D���%m!D���%e!D���%]!D���%U!D���%M!D���%E!D���%=!D���%5!D���%-!D���%%!D���%!D���%!D���%
!D���%!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D���%�!D��AWAVAUATUSL��$`��H��H�$L9�u�H��hdH�%(H��$X�1�H�S!��H�>H��H�H��!����H�
U!H�=&bH��H�?!H�5/�H�8�(�H�5*���!H�!H�8��<��!Ƀ��<E�1��L$����H�މ�A��H��!H���A�������A�ă���k	����D$I��Ic�I��DBD�����D$9A���D$-�D$8�D$.H�$H�D$0�D$/�D$;�D$�D$,�D$:�D$$���D$(��0���1�H���H�މ��o����ƒ����I�H��DAu��D$ �]�D$ <A���D$9�D$-�D$8�D$.H�$H�D$0�D$/�D$;�D$�D$,�D$:�D$$���D$(L�-.�f.���C��5wdIcD�L�>��H��!���Y���H�2�H�މ���!�������D$<�q�o���I��HcD$<I�H��DA�����?`H��H�މ��^����ƒ����I�H��DAt
�D$$����D$ ���D$$�4���H���H�މ������ƒ���uI�H��DA��D$ ����H�e�H�މ������ƒ����I�H�E1�DA������C��H�މ�D�dP�H�#�������tvI�Hc�DQuԉ����H�f
!H���H�މ���j����D$8�ƒ��t;fDI�Hc�DA������b����k!H���H�މ��*����ƒ��u�E��E����H�(
!D���
�%��	ȉtH�n
!H�
�(H�H�H��
!H��!Hc9��s�H�
9��u
H�,�H�=�
!���=�
!�7�|$.�,�=�
!�	H������T$(H�=�
!��T$,�=�
!�����=�
!��L��1�1��4����xH���H�މ��.����D$;�ƒ���������H���H�މ������D$-�ƒ�����������H��!H�H�$���H�Y�H�މ������ƒ�����D$�����_���H�0�H�މ�����D$:�ƒ���>����n���H��!H�8�B_H��!�;���H��H�މ��e����D$.�ƒ��������-���H�ɴH�މ��?����D$9�ƒ��������������H�����1��v���H���H�މ������ƒ����D$,���H�i�H�މ������D$/�ƒ���w������H��
!H�H�D$0�{���H�/�H�މ�����ƒ����I�H��DA�Z�D$���H���H�މ��l����ƒ�����D$(�Z���H�ͳH�މ��C����D$�ƒ����������E��A��E��H�/
!A��
��%��A	�H�<$D�"��H�<$�-H��H���^H���i�H��������H�$H��H�������H����I��H����H���,�L����H�<$�l����H���H�މ���
!�l����ƒ����
A��D$���H��	!�����H���H�މ��Z
!�$����ƒ���@
E1��D$���H���H�މ��'
!���ƒ����A��D$�{���E1�1�1���=�	!�M�=�	!�@�t$,����������=�	!u
�=�	!��	H��!D�t$/D�d$8�����H��!�����H�#!H�D����$�H�3�m^��uH���H�=S	!H���^H��u�H�;H���L�����H���_�|$-��H��1���L$E1�D��D��H�����{Ht0��5�!H�DmH��H�|�P��@��臑�CHH9���z�E���X����<$�N�����H�5���1������4����|$;����������=�!�@H�=-��D�H��H����H�=��,�H����ZH�E!H����1�H������C���H�\$PH���%H�&!H���mH��H���H��1��H���I���H�=�!��1�H����XH��!H��!����D$�D$ <�D$9�D$-�D$8�D$.H�$H�D$0�D$/�D$;�D$�D$,�D$:�D$$���D$(E1�E��A������1�D�d$<��M��A�ϐC��H�މ�D�|P�H���������I�4$Hc�DVu�D�|$��M��D�d$<���1�D�d$<��M��A��@C��H�މ�D�|P�H�3�������I�4$Hc�DVu�D�|$ ��M��D�d$<�����H��H������������T$.�D$:��L$9	Ѓ|$(��DD��t$��VD��RPAUH�|$PD�L$DD�D$@�T$0�UhH�� H���)��������T$(�\$,E1�1�H�=3!1���	����������|$/H��!�y�=�!u
�=�!�cL�#H�-��D�l$�M��$�M���AH�=�!H��t
I�4$�Z��t�D��!1�1�E��L���q�=�!A������D9�}�I�<$�.�E��H��I��H��!H�H��!H�81����j���H��!L�
�H�˭H�I��H��!�H�81��_��5���9���H�$H��!H�8���H�k!L�$H�t��H�H�1!H�81�������L$9jD��jjAUD�L$DD�D$@�T$0H�|$P�fH�� ����H�-�!H��!H�D�t$/�E����D�d$8�����D�l$�UH�=D!H��tH�3�?Y��t6H�;���H���[�H���H�߉E�E1�D��D��D��H����H���H��u����H�����=�!������=�!������=�!�w����/�Å���1��n�H�=�!��H���I���1�����=���H�-�����H��!L�
P�H��H�I���9���H�=�1�� �H��@��1���H�$����H���H�=3!1�L)��A���z�H��!��H�2���H��H�������=�!H�=�!u��G��=�!A��tVH��!H�
�!H�pH9��H�
y!H�pH�5~!H�A��
��A��@��A��>��D�8�|���H�J!��<u�F!�`���H��!D��H�0�'��I���D�|$ D�d$<���D�|$D�d$<���H��H��$P�$SH��H�57�H�!�����H�$�HD����H��!�<H�0��H�n!H�=�!H�0��H�X!D��H�0����!���H�=j!H���H�5d!�G�H�P!H����H�5H!H�=1!�$�H�%!H����H�-!���H�� �L$-H�H������P���H���1�E1�1�H�=.!E1��>��
E��t@��u5A��H�=!�c�����
���A��
uփ�#�1�E��tЃ�
u�H�f� ��A�H�0����D$ �d�L�=h!�H�Ͼ#H�L$A��m!��H�L$H��H����H��L��H�L$H�T$��H�T$H�L$�H���aL�=� H��H�D$I�7���:��H�T$I�7H���S�I�7H�=� �D�I�7�:������H�<$H��$P ��H��� L� H�D$HH�D$M��M�����H�=� H��tI�u�T����E1���I��I�����I�E N�<0I�G�H���wݾ{L���x�H��t�A�L��H���…�t-���\��L�CL�g�W��%����L��L�Å�u��H��H����������!�%����t��L�������D�H�SHDډ��H��H)���H9��?���H�SH��L���H��+����G�WH��H���C��O������{�e���H�t$1�H��L�$H�D$H���H�T$HL�$H��H��t�:}tA�$L��L�����H�@�H�$H��}w�H��\H�t$t�L�D$���H�t$L�D$H��Dp@t�H�$�C'L�C@�s�C'L�b�I�}���H���2�I���H��� L�����M��������D$ ���D$$�v�H�Ͼ=��H�L$H��H���,���H�Ͼ@��H�L$H��H���0����x>�&�������<�D�I�7H�=*� ��I�7H�=� ��I�7�>���;����D$A�����D$����D$,����D$��E1�����D$E1����D$A����D$,�D$(������H�
� ��H�=̓����[�H�=b��H�=s��H�=Q��@��1�I��^H��H���PTL���H�
�H�=(��"� �H�=�� H�� H9�tH��� H��t	�����H�=� H�5� H)�H��H��H��?H�H�tH�M� H��t��fD�����=�� u+UH�=*� H��tH�=�� �9��d����]� ]������w������1��f�H�������H��t"���t"���u����<?t ���[u����ې�<5uڃ�Hc��8��ht��lu�H�D8�f.�����ATI��UH��SH��H�H��t��|��L�H�0�(��M��0f�I���*��Y��X��EA�$��DVu�<.tT1���A�$</��<*t��tH��u��uI��<*u׹�օ�t�EfWϳ�EL��[]A\�f�A�T$I�L$H��DVtJ�MI�̹fD����f�I����0ə���*��X��MA�$H��DVu��M���I���E���f�AVAUI��ATUSH��H��dH�%(H�D$1�L�t$H���DH����t^�k<\u
��H���k<$u�@��<u�D�cA��.t��H�B�D`t�H�{L��L���H����8>HD����u�f.�H�L$dH3%(H��u
H��[]A\A]A^����ff.�SH����H��f�H���</t��DBu�H��[�f�AWAVLc�AUATM��USH��H�|$L�l$xH��$�H�4$H��$�L��$dH�%(H��$x1�Ƅ$�L��E��H�
׈1�H�����M�uI��H������L��L�{���M�|I9�u�H�|$�4�������*H�<$H�T$H�t$ �?�H�|$`�-L��$H�|$X�~L��$H�|$P�]H��$�H�|$H�<H��$�H�|$@�L��$�H�|$8��L��$�H�|$0��H��$�H�|$(��H��$�H�|$ ��H��$�ASARWPH�|$ 1��I�H�� H��$xdH3%(��H�Ĉ[]A\A]A^A_�@H��$�H�t$x1�H�<$���fDH��$�H��$�1�H�t$xH�<$����L��$�����H�t$x�d���H��$��C���H��$��"���L��$�����L��$����H��$����H��$����L��$��}����/�ff.�@AWAVI��AUE1�ATA�UH�oSH��8dH�%(H�D$(1�H�D$$�D$$H�D$H�D$L��B� L�;H�}L������t[H��H9�u�I��H��I��u�E��uM�nA�E<tb<�tpfDH�D$(dH3%(��H��8[]A\A]A^A_�D1ҾL��A����H�=�H��1����z���DA�}[u�H�D$�	H�D$H�l$A�\-���z������H��H��A�\-���^����DXu�A�|-A�K���I�6��D$%H�=����������D$$I�v�H�=Y���€���u�D$&E1�L�=\���u|K��H���X��H��H�D$teH�T$L��H�����H�L$��u}H9���G�'D:+D�T$t31ҾH������K��H�=�H��1��*�T$�^�fDI��I���j���H�D$B� ���d������D$$��$���H��1Ҿ�h��H�=y�H��1����1�H�߾�F���UH�=d�H��1���������ff.�SH�5Q�H�����H��t��[�f�H��H�55����[H���‰���AWE1�AVAUI��ATM��Lc�UH��SH��H�����ts�8�t7���E������0@�ƀ�;��@�t<m���CH��8�u�L��$�_��<�6A���DD��QH��L�q��u�H���U1ɾH��$�h��<�>��t���a�E��u�8��H����[]A\A]A^A_�f�H���h���L��H���]���I���A�����fDA�VI�N��m�]���I���
���fD1�A���t���$uA�~<��L������L��H�����H��I���s��K��I��L��I�4TH��1�H�H�=҉H��1������)����QE1�H��L�q���`�������@�QE���L�qDD�H�����7��������t#�������H���UH��$�������D�����H���1���1Ҁ8>��H����L���I��H�=ׁH��1��8���y���PXH���������ff.�USH��H���r��H�(�	DH����DU u����H�����H����H���1H����������!� ��t����€�D�H�qHDΉ�@�H��H)�H��H��t1�L��DM t%H�p��f���DM t�DH��u�H��[]�H��1�[]�H�=�����ff.�AUATUSH��dH�%(H��$�1�H���(��H��H��H���e����xO�D$%�=@u�H�������t
H��1��f��H��$�dH3%(H��ueH�Ĩ[]A\A]�H���J����tƉ�H��H�޿L�$E�,$A�$������x��D$%�=@u��H�������u�E�,$����fDH�/tmp/XXXUSH��H��H��GXXX�?���H��1ۉ�������xH�5������H�É�����H��H��[]��AVAUATUSH��H�$H��dH�%(H��$1�I��H��H��LD�H����H��L��I���Q���I��H����H�����������u{��tL������H���y��H�߉����H�߅�t����H�53L�����L��H�����L���A��H��� H��H��$dH3%(uLH��[]A\A]A^�L�����H�-� M��H��~H�H��� H�81����������c��H�=t~�w���H�=T~�k���ff.�USH��H���dH�%(H��$1�H�B�H���v#H��$dH3%(�2H��[]�f�H���� 1�H���H���tY�B��u��@�B����H������u��l$I�\$l@��t�|$iuH�=!�1�����f.�H�=�}�m�lL��$H��L����������B��u�H��H����u����$�����L������������L��H�=DŽ1��P�����H�=Y��l$I�\$l�2���9���H�=>�1�����J�������DUH��SH��H��H�H�H@H�Q�H���vcH�HPH�Q�H���vuH�p`H�V�H�����H�xxH�W�H�����H���H�Q�H�����H���H��H�����H��[]�1�H�='����H�EH�HPH�Q�H���w�H��1�H�=,��_��H�EH�p`H�V�H����v���H�=2�1�H���8��H�EH�xxH�W�H����a���1�H��H�=&����H�E�G����1�H��H�=L�����H�EH���H��H����?���H��H��H�= �1�[]����1�H��H�=����H�E��ff.�U1�SH���OtH����[]�f�H��H�����H��u��kH��[��]ÐH�G�SH�����H���w�?t	H��[�@�����t�H�=#{����H��t�H�{H)�H��H��[Ð��~TUSH��H�����H�-� �H�S�H��1�H�}����H�H�}H��[H��z�1�]���DH��� H�H��z�H�81�����AWE1�I��AVM��AUI��ATUS��H����L�%*� H��A��E1���A��1Ƀ�A�$������1���@��1���	����P1�����P1�����P1�����P1�����H�� H��I�E�H����H���v.L��H���#������A�$��usH��H��[]A\A]A^A_ÐL��H���������u�H������L��I������H��L���AWI��A��1�L��H�=݁�`��A�$ZY��t�fD��H�=�y1��@���x���H����c���L���H�=ʁ1�����K���fDL���H�=Ay1�����-����ATI��UH�������SH��H��H���C��uH��L������/��t��H�=x�]1�A\���fD[]A\�ff.�AWAVAUATUHc�SH��8H�|$(H�t$H�L$ L�D$�D$��t�M�A�A��D�l$H�|$1�1����I��H�@�H���wE�>A��t!�A���t&H��8[]A\A]A^A_��A�~[u�@M�,>@I��A�]�A�܄�t4�K��A��H��Dpu݃�;t؃�mu�A�}u�I��A�]�A�܄�u�H�D$�H�L$H�H;�8t#H�L$H;�@tH;�p	t1�H9�x	��E���G�������E1�1�L�1��@��A�׃��DB�I��E�>E��tUA��A�Dpuم�����t��&����0��A�Q�E��9�t.I��E�>A��1�1�E��u�f.��������9��������tH�D$(H��@<��x
�D$�����H�D�H�T$ H��8H�=wH�tEH���[]H�A\1�A]A^A_�~��fDA�1�1��'���f���AWAVAUATI��USH��H�t$TdH�%(H��$81�H��� �8��=�� �A�D$<M�|$ H�$f���L�d$H�$I�4ωωL$H�V�H�t$H������L$(�����H�t$�VB)��V@)����N>��H�V0H�H��#��E1�L�%���f�I��I��@�RL��H��D��H��L�������u�H��E�d,�H�=IvH�������uI���
�DD�H��$�H��H�U	fD�H��H9�u�L�|$A����/E1��fD��I�τ�t/I�OA�W<%u������p��A�GI�OI�τ�uҐ�|$�D��$�v	E���dE9�A��E���wH�D$H�L$H�@ H9�D������u	E����H�|$H��$�H�T$x�R��9D$xMD$x��D9��sA9��j�;u��0�C�PЀ�	��0�{��0<6�
#���#1�H��H�=~�����|$��&HcD$(H��� L�t$H��H�D$ A����@H�t$ �H�=�t�����t H�t$ �H�=�t������GL�D$xH�|$L����H���,�\$x��� H����H���D�\$xE���H�t$ H�=kt1������A�\$<��kHc�H���g��H�|mH��H�D$H�t��I��H����1L��� 1�A�{��t^I�l$ 1�1�L��D�
Hc�H�@N�D�H��I�M�P�I���w�8H�=f� ��L�@J�<�H�xI�D�VH��I�Ӌz��u����vwA�T$>A�D$@��M�L$0�A�T$B����)�)�)���Hc�M��Hc�H�@H��A�8kI�uL�@M�D$ �������M�8L�@I�D��H��9�u�H�|$H���0A�����L�|$�D$(H�D$ �$L�|$L�d$X��H�\$L�l$ ���gH�L$�$D�,$H�|$L�aK�DmH��I�T$��H���w…��3H���D$L�t$HL��H�L$0L�l$8H�\$@f.�H�sH�V�H�����I�,�}��L���X������H�D$ �|$L�{A��E�{�|$(��H�-�� ��H�=�qH�M���H�D$H�t$0�8���H�M��H�=bq����;L������D$�D$�D$(@A�EH�L$H�@I��H��D�;E��� ����|$L�l$8H�\$@�C�H�\$L�l$ ��������=�� L�|$L�d$X�@E�/E���4H�D$p1�L��L�<$H�D$H�D$xA��H�D$L�d$�"DA�GH�$I��H�@H���*����H�BH��H���w�L�rH�-�� A�E1�H�'p�H��H�]�A��H��t�H�����I��L��H��L���f����u�H��L��������t�H�L$H�T$1�K�<&H�5 p���������D$x���T����
�=���L��H�=�o1�����'����H�� �
H�0�$������DE�oE���z�5��I��H��DP�cA��0A�GI�OE9�EL�Mc�BƄ,����fDH�t$ �H�=�o�����tH�t$ �H�=�o�����u)M������L9D$tA�;uH�t$ H�=y1��'���-�� @����
H�D$L�x �@<H�$H�$��9�����L�d$L���Y�I�D$�p4�P8��������8��M�|$ L��9�~I��`	�f�I��p	H�Q�I��x	H��H����`H����!I��8H�Q�I��@H��H�����H����t!L��I��h	I��`	H�Q�H�O�H����QH����� L��H��p	H�W�H���wH��8H�V�H����� H��x	H�W�H���wH��@H�V�H�����I�T$D�R4E��xBD�J8E��x9H��p	��H��x	��H��H	H�W�H������I�T$H��`	H���z�vH���vH��X	H��H����GI�D$ �zH�$���z��I�<$�+����I�\$ H����$H��pH��H�����H���H��H����(H��PH��H�����H���H��H�����H��XH��H���wH�CXH��H�����H���H��H���wH���H��H�����H��xH��H���wH�CpH��H����ZH���H�Q�H���wH���H��H����H��X1�L�F�I���w
H��$��H���H�w�H���wLcȃ�J��̐H��xL�O�I����PLc�D�HJ��ԐH����OMc�J��̐���;H��$��>�I�\$ H�sX1�L�v�I���w
H��$��H���H�j�H���wHc���H��ĐH�CpL���L�@�M�}�I�����LcɍyJ��̐I�����Hc�L��������H��$���I�\$ H��XL��`H�E�I�U�H����RH���wL��hI�F�H����O�H��Ƅ$��p�H��x H��$��PH�5cl����L��`L���C�H��xH��$��PH�5;l���H��h��H��xH��$��PH�5l���H��p���H��xH��$��PH�5�k���H��x���H��xH��$��PH�5�k�g�����$��QH��hH��H���wH���H��H����+ H��
H���	H�W�H��H�����H����)I�D$ H��H��
H���	H�Q�H��H����9H����I�D$ H��H��
H���	H�W�H��H�����H�����I�D$ H��H��
H���	H�Q�H��H�����H����#I�D$ H��H�� 
H���	H�W�H��H����+H�����I�D$ H��H��(
H���	H�Q�H��H����H�����I�D$ H��H��0
H���	H�W�H��H�����
H����EI�D$ H��H��8
H���	H�Q�H��H����M
H�����I�D$ H��H���
H��H���wH���
H��H����}H���
H��H���wH���
H��H����7H���
H��H���wH��xH��H�����H���
H��H���wH���H��H�����H���
H��H���wH���
H��H����mH��x
H��H���wH��H
H��H�����H���
H��H���wH��P
H��H�����H���
H��H���wH��X
H��H����[H���
H��H���wH��h
H��H����H�V� D�(E����M�|$ M��I�GhH��H���wI���H��H�����I���H�G�H���w-I���H�F�H����(��������M�|$ M��I�GH��H���w-I��H��H�����I���M��H��H����=I�A H��H���wI�� H��H����"I��I��8H�W�H�A�H����
H��� �H�����1�L��L��g1��8�H�������H����H����I�|$ L��g�H��H����I�|$ �H��L��gH�� ���I�|$ �H��L��gH����I�|$ �H��L��gH�����I�|$ �H��L��gH����z�I�|$ �H��L��gH����Z�I�|$ �H��L��gH���:�I�|$ �H��L��gH����I�|$ �	H��L�~gH�����H������M�L$ I��8H��H�����M�l$H�-��A�s1�L�=�g�D�uH��M��8I�@�H���wH�4$L����L���}�M�L$ M��@I�@�H���wH�4$H�
vg��L���R�M�L$ M��p	I�@�H���wH�4$H�
\g��L���'�M�L$ M��x	I�@�H���wH�4$H�
@g��L����M�L$ ��E���C���I���H��H���vI��PH��H���wI��`H��H����tH��� H��t
�t$TL���H��$8dH3%(�!H��H[]A\A]A^A_�DHcD$H��� H�€;uu�C�PЀ�	w�{u<6�C��T$H�ƅf�<P�-��|$����H�t$�L$(L�t$�VB�F<)��V@)����N>��H�V0H�H��H�D$ A������E1�E1��f�I���؄����A�^<$u�<u�I�FH�D$@A�F�D$0�����|$0>�b
1�E1�1�L�t$8M�fE1�M��A��݉��^�k�����H��Pu��H�=b蠹��H�����A�\$��D	�M�\$DE�D�DD���t4��>��M�܀�*t��/u���*t3��A�\$M��M�\$MD��u�L�t$8�\$0M��I������@A����f.��|$��RH�|$�L$(1��WB�G<)��W@)����O>��H�W0H�L�4�H�D$�8k��H�|$�1��D���L��H�=PaI��H����	��H��L��葷��H�D$H���C�����H�=LaL�������tY�H�=7aL�������t?�H�="aL�������t%�H�=aL��������L�H�D$H�@�@4�D$����1��,@M��L���L��H�=j1�1��
�����9\$����L��L������H�t$L����I������L��H��I���S�����t�@��t�H�-�� L��1�H�e`H�}蹺��H�}L��1�H�a`�蟺��H�L$H�}1�H�Q`�胺���F���fDH��� ��H�=1_H��H����;L���>����f�D��H��H�=�g1�����E��E�����E1�H��H�=�g1�����s��H�=�f1������DL�d$I��L���h���H�|$H�^�����f���D��M��I��L�t$8M����	H�|$@1�H�L$pH�T$xH�5�^L�\$0�$���L�\$0��u�D$pA8Eu	@���`H�L$@L��H�t$ 1�H�=�gH)��8���A�FM��M��I������@E1�����H��H�=ff1�����J�f.�HcD$(H��� L�4�H�ـ�B����L�t$8M�\$A�$M��M���\���fD1�H�=gh袷��M�|$ L�����D1�D��D��H��H�=�f�y���A����A�L�-m]�
I��E9����B�|=u�D��H��L��1��;�����f�H����vL����fDH�|$�>1������fD���H�t$hL��H�D$hH�D$p����H�|$H�t$p1�I�����H��L��M9�����;���L�l$xM��L�|$8I���D$H��@�l$0L�t$ L�l$(�AfDA��$�>I��A�/M�w@��\tlM��A8��I9��A�?�E�,$A��\u�襷��A�|$M�D$H��x��@��^�RA�/I��A��M�w@��\u�fD�c���E�OH�B�Ht�I��D���w����H����d���H����Z���H�m� ���u/H�=�^1�衵��M�L$ I��8H��H����/����L���X���H��H���6�8��M�L$ I��
I��8H�F�H�����
I��XH�F�H�����
I��`H�F�H�����	H9������H��觱��M�L$ ���DH������H�=l1����I�\$ ��fDH����a�H�=�k1�踴��I�\$ �I�fDH�����H�=_k1�萴��I�\$ ���fDI��������\�I�����H����H�H�����H��wI����0�L���ʱ��H����1�H�=�[�"���I�\$ H���H�h�H���vH�=h[1����I�\$ H�CpH��H�����H���H��H������H�=k[1��ij��I�\$ ��f.�H������H�=j1�蘳��I�\$ ���fDH������H�=�i1��p���I�\$ �k�fDH����)�H�=i1��H���I�\$ ��fDH������H�=h1�� ���I�\$ ��fDH����u�H�=�g1����I�\$ �]�fDH������1�H�=�d�в��I�D$ ��fDH����]�H�=/d1�訲��M�|$ �B�fDH����������fDI����FH����H��xH��H�����H���H��H������H�=�Y1��4���I�\$ ��f.�H��PH��H����=��#�fDH���vH��X	H��H������1�H�=�d�ױ��I�T$I�D$ H�$�z�w�H�5�XH�����I�\$ ��fDH������H��hH��H������H��pH��H������H��xH��H����n���f�H��H�=�_1��?�����|$L�t$ ��L��H�=�a1�����H�D$H�$H�$L�x �@<��9�����H�=H\���H�=�X���֮��I�<$�D$I�D$�X�@����H�=�XH��H�D$�A��A��E��E���5�D$E1��C؋D$��A��<v�D$E1�@����
E1�E1�1�M�|$ 1�I��M��L�_�I���w�H�5?X�������I��P	H�G�H�����D�T$@D�D$8L�L$0�L$(L�\$ ���L�\$ �L$(L�L$0D�D$8��D�T$@E����E����E���wH�=i1�詯��M�|$ M�����@H��$�H�=!d1�肯��I�\$ ���I������H�=8V���������A�I������#���Dj1�E1�E1�j1�1�1�jj���H�� H���)����H�Ņ��Y�1�H�=;W���H���K�H�=�W�1���f�H�=Aj1��®���y�M�^E1�1�1�M�cM������fDH�5�UI�|$ ���I�\$ �c�DL��H�=�\1��o�����f.��.H������1�H����H����L$DE����D1�H�=�a�"���I�\$ H��pH��H����:�H��PH��H����%�H�=�a1����I�\$ �
��H��P	H�W�H����+�1�H�=`譭��I�D$ ��H�=RW1�蒭���*���DL��pI�G�H������H��xH�B�H������1��}uH��H�T$���H�T$��$�1�A�}uL��H�T$���H�T$��$�1�A�>uL��H�T$�v��H�T$��$�1�A�?uL��H�T$�U��H�T$��$�1��:uH��H�T$�5��H�T$��$�H��$��H�=[TƄ$�H�T$��������H���1��L��H��H��$����L��L��$�I��H��$����L��H��$�����H�T$H��$�H������H��I�~(L��H��$�L��H���M�H��H9��EH�2H��y��3�fD�������=�� ������DHc�L��̐I����+�H�=�R������������I����E1�H�ƹH�=�O�������A��H�����H��D�L$���D�L$H����I����I����
���H��H�=�T�>��M�L$ I��8H9��
�����H�=�]1�����I�T$��@H��8tH��@�3�H��h	�%��=�I��H��� L��J�t(H�=�XH��HD�1�襪������H�=�e1�蒪���"�H��H�=�S���M�L$ I��XI��8H�F�H����0���H��H�=�S�^��M�L$ I��8����DA�|$<���H�t$(L�����I9����L$0I�ĈL$��D�K������
I�D$ �	�f�H�=�Q1��ҩ��M�L$ ����H�=�Q1�販�����DH�=�b1�蚩��I�\$ ��H�=ib1�肩��I�\$ �O��H�=!b1��b���I�\$ �	��H�=d1��B���M�|$ I���M��H�G�H������I���H�F�H��������H�=�c1����M�|$ M���O�DH�=)d1��ڨ��M�L$ ��1�H�=\�¨��I�\$ H��PH��H������H��pH��H���������fDI��H	1�H�G�H��������D�T$@D�D$8L�L$0�L$(L�\$ ���D�T$@D�D$8��L�L$0�L$(L�\$ �`���f�H�=q\1��"���I�\$ H���H�Q����DH�=!\1����I�\$ ��H�=�[1����I�\$ �S��H�=�[1��§��I�\$ �
��1�H�=�X袧��M�|$ I��p	L��H�Q�H�������I��x	H��H����J�H�=�X1��b���M�|$ �2��蛧�����\I�D$ �3��f�H�=�X1��"���M�|$ I��h	L��H�W�H�������I��`	H��H��������1�H�=/X�ڦ��M�|$ I��8L��H�Q�H����d��I��@H��H�������G��1�H�=�a蒦��M�|$ I�GM��H��H����;��N�1�H�=[�b���I�\$ H���	H��H�Q�H������H��
H��H����*���1�H�=W\����I�\$ H���	H��H�Q�H����4�H�� 
H��H����B���H�=�[1��ҥ��I�\$ H���	H��H�W�H������H��
H��H����"���1�H�=[芥��I�\$ H���	H��H�Q�H����@�H��
H��H������#�H�=qZ1��B���I�\$ H���	H��H�W�H������H��
H��H��������H�=�]1����I�\$ �{�H�=A]1����I�\$ �=��H�=�\1��¤��I�\$ ���H�=�\1�袤��I�\$ ���H�=Q\1�肤��I�\$ �k��H�=�[1��b���I�\$ H���	H��H�W�H�����H��8
H��H����B���1�H�=[����I�\$ H���	H��H�Q�H������H��0
H��H����"��{�H�=qZ1��ң��I�\$ H���	H��H�W�H�����H��(
H��H�������H�=fK1�芣��I�\$ ���L��H�=�I�q���H�D$H�$H�$L�x �@<��9��`���U��M��������pE��u&��u"@�t$I����JH�=�\1������t$����@��uI�D$�x4��~H�=�\1����M�|$ I��8M��H��H�����H�=]1�転��M�|$ M�����fDI���wL��D�L$�%���D�L$H��w	E���o��I����e��B�f���A��E!���f�H�CPH�S@H��H�����H��H�����1���H�K`H��H���w����H�{x�
H�O�H���H���F�F�H��H���w����H���H�O�H���H���H�KX��H��H���H�O�H�����H���H�Kp��H��H���H�O���H�������	���V�������b��H�=�T1��v���I�\$ �J��@H�=�H1��Z���I�\$ ��H�=_H1��B���I�\$ ����1�H�=#H�"���I�\$ H���H�p���DH�=1Z1����M�|$ M���,�DH�H���Y�D��$�E1��4���t$�����������D$����H�|$�+L�L$�X���L�L$H������H�=[�~������f��
�
�'���H�=�G1��S���I�\$ �b�M��1�I��L�\$@���1�H�=�I�(���M�L$ I��
M��H��H�����I��XH��H������M��I��8���H�=�Q1��ٟ�����H�=�Q1��Ɵ�������L��H�=�FA�^���I�����'�I���8�H����,��?�H����hH�����H���l�I����I��L�����H���P��2��@H�=R1��2���I�\$ ���I�D$D�@4E���0���H�=�X1����������D$���H�D$ �8k��E���HH�D$H�@�x��������H�D$H�8�7����+H���j���H���i�E��H�4DH�5:DH�T$ HE�H�=8N1��y����<�@E�,$�������-D��H��H�=�M1��I�����L�|$8L�t$ 1�H�=�NH�L$L��L���!���H�D$L�x �@<���I�������L��荛��H���������H�=�P1����I�\$ ���H�=�W1��ȝ���t$���I�~ H��1�1�I9���H���H9�t	L�hH�0������Ƅ$��I�����L��$�L�--Z1�I��d�������L9�~M9�}H��H��tL��M�<Ɖ։�L9��I�ω��߃�w"IcD��PL�>��L��H�5�D�}���I��M����u�L��H�=hQ1���I�\$ ���L��H�5�D�H���I����L��H�5�D�4���I���L��H�5{D� ���I���L��H�5bD����I���H�-�� H�5"BL�l$ �H�uH��L�����������H�;� H9�u�H�t$ H�=
X1��K�����H��H�=fB1��5������=ѯ �h�����I��XI��8H��H����������訙��H�=�A輾��H�=�A谾����H�=�� SH��t�*���H�s� H��tH��覘����u[�H��[�����SH�� L�1dH�YEH��� �H�1�H�;聜��H��NH�="Y��X�����>���ff.�AT�I��USH��H�=EH��H��dH�%(H��$�1������uBH�S� L��H�5�DH�8�	���H��$�dH3%(��H�Ġ[]A\�fDH��H�޿� ��������l$�����@tM����t���u8H�5lEH���Қ��H��t]����x���M��tL��H��H���n����`���H��� I��H�*DH�H�V� �H�81��/�����������H�Q� I��H�DH����Ŗ���8����I�ؾH��CI��H�� H�H�� H�81��њ���觚���AWAVAUATUSH��H�$H��H�$H��dH�%(H��$ 1�H�����/I���!���I��H���L��1�A�E1�����H��H��E1���H������H���WH�� H���o���H��u�A���MA���aH���N����=�� tcM���TH�
�� ��H�=�T这��M�$M��t41�H�-�BD��H�=n� H��1��پ蝙����M��M��u�H��$ dH3%(L���"H�� []A\A]A^A_�fDA�1�L��E1���L����,tD�U��t�Չ�L����,u�A��t4����H��tD��A��I�ԍ}H��L������������A�G��tX�UA�lj��fDM��tsD��I��A�����A�}�����I��H��t=H���e���A���P���@E1����A��A��ܕ��I��H������H�=tA�$���@H���������ATUH��SH�7H��tAH�_L�%VA�@H��H�s�H��t#L��H��舗����t�[�]A\�f.�[1�]A\�f��=Q� ���E� H�&dHc�H�>��@��f�1�����������+w�H��l�0�f���������������@������uj����v���(�����4v���d������������	��f���t;��u.�����R��������4����1��D����Ð�����f���&������H��k�0�f���#����H�;i�0�fD��
���f��к����I���4��A����RD��)ƒ�t.��tQ��L�0dH�G����Hc�A���1��fD��L�dH�G������?A���1����1H��cA��?��?�2B�
�H�G�W���f�����t/��tC��uH��� ��H�@ H�<�����fD1��DH�y� ��H�@����H�a� ��H�@�0��tø�����@AUATU��SH����t>I��I��1���޿�T�����tH�� L��H�4�蝒����tH��9�w�H��1�[]A\A]�@I�D�H�P�H����HC�H��[]A\A]�ff.�@AU1�ATUSH��H���H�S�H���wC�+@��t6I��H��L�-�8D@��L���L���H��t@:+u"H���k�@��uݸH��[]A\A]�DIDŽ$�H�=��IDŽ$0�\������DAUI��ATL�bUH��SH��H��H�GH�OH�?J� H9�s H��H�s�d���H��H�H��t,H�CL��L��H�跏��H�HkH�k�(H��[]A\A]�H�=���!����藓���SH��H��H��u#H�GH��H��1�H�5�6[�E���DH��H�t$��H�t$H��H��H��[����ff.�H����� ��� H�q� H��tIH�]� H��H€: u6H�
J� ��H�H��H€: uH�2� �H�(� H��u�H�54� H�=
� �(����� �(� H����AWAVAUATI��U��S��H��hH�=�� dH�%(H�D$X1�����ÉD$�ˤ ���ϥ @��t�ʥ ;�� �������u	�=�� uOL��H�=u� �������L��诎���� H�D$XdH3%(��H��h[]A\A]A^A_�fDD�-A� E��x�J� A9�}�H�2� L��E1�1�H�D$0�P���A�$I��L��A��L��A��L�ED��1�E��u,�f�D�N��tXHc��0D��I��A�P���tb�� u݅�uAI�����9������������@H�5�� H�=z� ����	���D���Hcֹ\s��H�f�
�B뒐����Hc��0���(D��H��I�Ƌ
H����������!�%����t������D�H�JHDщ��H����D)�D$� � �����`�=L���S���H���XH��L)��H�|$O�N�L�
r}H�
m}1��T$8A�к	�͐���=�� ���
L����H��tn�D$L��~H��H�=Y� �t������H�D$0H�_� ���H�D$XdH3%(��H��hL��[]A\A]A^A_�p�����������.� �D$������A�� � H�L$O�l$<AM�H�L$(E1��D$�D$��fD�D$�آ ;D$���\$+\$E���!D�d$Mc�E)�A9�DO�E����E��A����C�<Lc�G�A��A��\���|$$L�L$D�D$ D�T$�g���K�.D�T$D�D$ H�0A�D$�L�L$H��|$$��…�t�M�\H����\���^u�D��A��%��A�D$�K�.H��@A�<M�LH���|%��A����u�A9�DO�Ic�K�4.D)�H�=�� E��!���������������� �D$���H�t$(H�=d� ����+\$8����M��D��C�|�\u��A9��Q���A������~C�|�\D��tZ�GH�A�4�E� �����=��'�K��{�UH�=�zD�D$ �T$�^���D�D$ �T$H������A�DA9�AL��
�����l$<���V���Ic�L�E���8���H�t$OH�=�� ����"���DH�AzH��� ��� ��~W������I�蟋��H���6���H�=�y�j�������H�5Q� H�="� �=���������D$O�D$8�q���fDH�=�� t�D$@��������D$������>t1���+��A�D���A�@�������Hc��L��
�H����}t�L�Dž�u�A�@���A�D8����Ԉ��@SH��览��H�ߺ[���W������SH��1�衋��H��H��趋��H��t�P��t��td��t01�[�@H�P1�f��%�H�
�`�<t�H��� [H��ÐH�P1�f��+�H�
�`�<t�H�w� [H���f�H�P1�f����H�
�]�<t�H�.� [H������AT��U�
�� S�L$0�t$(�\$ D�u� �
{� �L$8D�
`� ��E��@�5f� �
Y� �W� H����I���H�=�wL����������'�5� �+� ��wkH�
WHc�H�>��H��� H��� H�K� H�|� H�� H�f� E����H�G/A����H��� H��wH��� ��� ��� ���N~T�����u2����H��fH� � H��eH�
� H�S_H�� ����[]A\����u��t�L�%� H�-� H�:x1��I�$H�}趉�����H�=�vL���������������H�=�vL���������������H�=~vL����������3�H�=bvL����������$��� �X���DL�%Q� H�-*� �p� D�
m� H�x�D�:� �D$ I�$1�H�}[]A\�ۈ��H�I� H��� H�� H��� H�}� H��� E���(���H��u�-���f�H�q� H�r� H�{� H�\� H�=� H�F� H��uH��� H�wuH��� ���D��� �d��������H�qlH�"� H��kH�� H�5eH��� �������������u<H�tH�� H�gsH�К H��lH��� ���������DL�%� H�-�� H�3v1��I�$H�}臇���DL�%�� H�-�� H�+v1��I�$H�}�W����*���f�L�%�� H�-Z� H�#v1��I�$H�}�'������f��~� �D�����H�=#tL���������������O� ����f���SH���S�����~r�H�E1�L��sL�LL��s�#�H��L���������t8H��L9�t&�H��L���������u�H��A�L9�uڃ�2��A!�D��[�E1���AWI��AVAUL�-dsATE1�UH�-�RS��D�sH��(H�|$H�׉L$H�t$�2���A��D$��tg�� I�_��T���HcD�H�>���L���H�=� E1���I�GI��H��L���H�=�� �k�A�OI�߄�u�H��(L��[]A\A]A^A_�DA��E��t�H��� H��� E1��D�
A�?e�{�|$��x �L��H�=Q� A����E9�u�H�5XrH�=0� ���L��H�=� ���A�??�s�|$��A�OE1�I������f�E�������|$��D�%� E�������H�D$E1�H�8����H�T$H�=�qH��1�腃�������H�5�qH�=�� �8�A�OI���a���D"d$�D$�����H�i� H�Z� E1��D�
�D$��x'f.��L��H�=1� A�����E9�u�H�58qH�=� E1����D$�/���fDE1��!����t$��~'��L��H�=і A���x�D9d$u�H�5�pH�=�� �Y��L��H�=�� �E�H������D$������A�O��%A�Ą���A ���D�d$I���@���D�%�� E�������H�D$E�gH�8�~��H�L$D��H�=KpH��1��������H�� H�� 1�L�%p�D�
��źL��H�=� ���E9D$u�H�5�oH�=ƕ �q��L��H�=�� �]�A�%��I�����H�t$H�|$D��H���%����I�DŽ�A�Ā�%��A ��P����H�5(H�=W� 1����T$��x�L��H�=9� �����D9�u�A�E1�����A�GI�߄��a�����H�=Do�~��H���I���H��� E1�L�-�nH�PH�� H�Ք �
�A�ĺL��H�=�� �h�A�D$D9�u������H�5['H�=�� E1��>��L$��������L��H�=s� A����E9�u�A�OE1�I���;���D��AWAVAUATUSH��H�$H��H�4$H��H���ՉL$LD�D$HD�L$<dH�4%(H��$x1�H����1�H�=� �+����K�
� �#� �K8E1�L�l$`�D$M���D$ M��f�����*f.��S>��D��)�H�S0)�Hc�L�$�D��1��}��ń�tb�=ē ��1�D��H�$�Ѓ��tA�L��L���D$�~���L$���
�D$ E�ED9�DC�D�D$ L�����@�l$�K8I����D9���E��A��+w�=E� t[H�� F�,�Ic�A��+�;���H��� L�$��D���H�!� �8�N���A�<$O�C���A�|$T�7�����H�q� Ic�L�$����D��� 9�� ��
�=�� �A�K:1�f�����D$1�L�t$`A�DA��&w�=y� �#H�� D�<�Ic�A��&��S@��D��)��S>)lj��H�S0H�H��H�D$D������A�Ą��4�=� ��D���H�$�Ѓ���H�CE��F��E����L�D$L���1�H�
�k�L�T$��~��L�T$L���H����������!�%����t������D�H�WHD���@�H�CH��L)��=z� F����A�����Ic��D����@��L��H��H�P�H9�r�H��H9�s�H�
4kL�1��H������~���D$E�OD9�DC�D�L$L���c�D�d$�K:H����9��S����l$��� 9Ő t�=�� ~�	�H�;��y��l$ 1��@�ǃ=�� �D8
�D$�D�c<H�D$`E1��D$8H�D$@fE�����D�=Y� �+H�� F��M��Ic�A������SBA��D���s>)��S@)����H�S0H�H��H�D$D������ń��#H�S J��H�D$ H�4�ۏ L�.����H�t$0H�T$(����H�|$��x��H����H�T$(H�t$0H���H��H���vH��`H��H���w H���H9��8H��PH9��XH��8H��H���wH��8H9���	�D���H�$���D$`I�U������H����6L�t$@L�D$�1�H�

i�L����{��L���I�@�l$D�c<I��A��D9���E��A����N���M��Ic�A����f���H�� H��H�D$�}���fDA�@fD��������K:f�������1�����Hc�H�΍ H��H�D$�����H�9� �8����H�D$�8O�����xT���������H�	� �8�����H�D$�8O������xT����������L$8A�F9�C��D$8��� �P������T$<1���L��@���yx��1�H�=@� I���x�H�t$H�=,� �g�H�5�gH�=� �T��=T� t
�=X� �nL��H�=� �/�L���Wv���t$H�=܌ �D�D$��@�l$H�C H�|$ L9,8tL���3u��D�c<I��A��D9��/����D$�t$8�p�D$�� �������v�|$��L$H��uH�=|� ��u���D$H��$xdH3%(�D$��H�Ĉ[]A\A]A^A_�fDH�
�?���@H����S����7����L�D$�L��1�H�
Yf��@y���0���H��� Ic�M��H��H�D$����D�T$<�L����v��I��A�����D��H��F�HH�|$L��L�L$(�t��I��H����H�|$��t��L��I����t��H�|$�H��A�t�o��u�H�=�e�[����L���L�L���t���t$�D�D$�9����Q� A�$1�H��T$<H�l$`��H��@���v���=�D$`box1f�T$d�8I��tjf��H����������!�%����t��L������D�H�SHDډ��H����s��H)�H�TH��vA�H�PH�|�L����t��H�����=�� t
�=�� ����H�[� �������H�C� �H��
��	�����������:������H��<
	������H��<

�|����H��<
\�o���H��H��� �lf.�1Ҁ8k�,���H��H�D$(��L�L$(�������=� L�L$(��D�D$LE������H�|$L�L$��r��L�L$H�T$@D�pH�t$@A�I�I�D$`��uH�p�<\�L��I��I��H��A�D$A�I��I�II)�A�D$����I����L�b<:u��\:H��I��f�z��@H��������H�D$@�im=H����@�l$D�c<�1���H��P�����H�D$@�ei=H���O�@�l$D�c<����H�C L���I�P�H����ML���I�@�H�������H�l$`H���1�H�
�b�u��H���������DH�k L��XI�D$�H�������H���H�G�H���wL���Mr�����nH���H�G�H��������L���(r���������HDž��r����K:1�f���O����3���@H�3H�=�� ���D�\$HE��u"H��� ���t���:u�=H�����u�H�5�� H�=o� ��H�k� �=p� ��� �Y�����O�fDH�)��H�=چ H�$��f�H�[ H���H�G�H����q���H�l$UL�->a�lI���'�I���@A�uI��A�D$�@�������H����Ep��H��u�A�$� ���fDH�t$�L��H��������H��<

�����H��H��� ���� H�58`H�=f� ��� �{������fDA�AI�I�B����H��I�����L�D$�L�T$H�q`H�� H�H�� H�81���r��L�T$A�D$E�D���	H�=p����E�f�L�t$�D��L������L���o���
H�=\`A)�D�����H�|$@A�t$�����@�l$�K���H��� L��H��H���
r��L��H��H�D$(�o��H�T$(��H�C ��I��L���:���H�l$`H�
�_�1��H���Zr��H����H�C L���I�@�H�����������L�t$@L�D$�1�H�
�`�L���r��L���g�@�l$���H9�8�j���H���m��H�C �Y���E����HDž����L+d$@E������m��D��AWAVAUATUSL��$��H��H�$L9�u�H��D�-[� �t$I���L$L�D$dH�%(H��$�1�E�����=� ��H�o �����H��^A�A�H�D$H���L$1�E��D�L$H�t$L��H�Ӄ �F�����A9��� ��s�Ճ ����I�I�_ M�oM�gH�D$(I�GH��I�o(H�D$I�G0H�D$ I�G8H�D$8A�G@�D$0�B������H�D$(M�oM�gI�H�D$I�_ I�GH�D$ I�o(I�G0H�D$8I�G8�D$0A�G@H��$�dH3%(�H��[]A\A]A^A_�fDH�}H�G�H���w3�*�Hl��H��t$1�H�x�
�m��f��tI�W����I�o L��8M�t$�I����	I�WH��PH��H���v#H���H�H�H���wH��PHDž�H��XH��H���v0H���H�H�H���wH���H��H����f.�������1�I���w�H�5�L���������I�W�B)I�o H�}pH�G�H���w,�*�=k��H��t1�H�x�
�xl��f���oI�o H��0H�G�H������*�j��H����1�H�x�
�3l��f��tI�W����H��[I�o E1�A��H�D$�V���DH��$�H�H�DŽ$�H�-�H��$�H��H� � H�-� �� ��k���������� �txH�=Ѐ ��H�=W[E1�H��$��K���$�L�->[��t;f�F�#L��PH��1�I���m��H����D9�$�w΋x� ��A���H�=P� DŽ$��7H�=�Z�����$����
���E1�H��$�L��$�f�D��L��H��H���/��A����D9�$�w�D�ຫ�������RD��)ƒ���������H��L��H�5D �����:�H�=?Z�.��z���f��*L����h��H�����1�H�x�
�*j��f���1I�o I�W�L��8���M�t$�����I��L$H�D$ I�GH�D$@I�GH�D$0I�GH�D$(I�G H�D$HI�G(H�D$PI�G0H�D$8I�G8H�D$XA�G@�D$`����D�L$�L$1�E��H�t$L���J�A9������A�W<I� f�����1�D�l$d1�A��L��I���Nf�D�L$�L$1�E��H�t$H����A9���H�{ �S<D��I����A���9��J����H��H���w��CB�K>)��S@B��8���H�S0H�H�,�HLJH���Bg��H���h���D��H��H�5SZ1���i���J���f.�D�L$�L$E��1�H�t$L���5��V���H�XE1�A��H�D$���fD�J����q���H�� H��H����\�������Q���@D��H�5vY�1��i���D$�X���DH��D�l$dI��H��H����X@���p���������'} D��H�5�Y�} �D$h1��h��D�L$�L$1�H�t$E��L���@��D$lA9����D$h��| I�G H��| H��H�D$ I�H�D$@I�GH�D$0I�GH�D$(I�GH�D$HI�G H�D$PI�G(H�D$8I�G0H�D$XI�G8�D$`A�G@�$���I�W�������I�o I�WL��8M�t$�����H���H��H�������H��XHDž�����@H�{ D�l$dI��H��H��H���w!HLJD��H�5FX1���rg��D�L$�L$1�E��H�t$L����A9�}2I� �Y����t%I�G D��H�5*XHǀ�1�� g��D�L$�L$1�E��H�t$L����A9�������"����H������A���H�=�
�������D)�1�D�d$xH��$��D$dA���D$t�D$pD�l$|�@A��A���JE��H�
NUH��1��
���g��I�o E�o<H��D��H������H�P�H���w�E��E��t�H;EtH�UA�H�H�4�H9�t�H��H��H;B�u�H�EH���~c���l$p�D$t��)ʼnl$p�^���D�d$xD�l$|D��H�5RW�1���e��D�L$�L$1�H�t$E��L���k��D$lA9��+���D)�D$d�<D�d$pD�t$tA���A��A�����E��H�
KTH��1��
���f��M�w A�o<H�ډ�L������H�P�H���w�D��E��t�I;t(I�VA�H�H�4�f.�H9�t�I��H��H;B�u�I�H��A���kb���l$d��)ʼnl$d�X���D�d$pD�t$tD��H�5�V�1���d��D�L$�L$1�H�t$E��L���]��D$lA9�����I�?�`���\$l�H��VI��H��w A��H�H�yw H�81��We��H�L$��1�H�5V��Md��������T$tD�d$xD�l$|��������9���DH��L��H�5�w �i������H�=�R�������D�d$pD�t$tE���=������H��H��H�������+����Ia��f���SH��H�$H��dH�%(H��$1���w I������vW@��H���H�=RL�1RH��LD�H�
,R1��d��H�����H��$dH3%(ugH��[�H�Aw H��t�H�-w H��H€: u�H�
w ��H�H��H€: �f���H��v �H��v H��u��K����M`��ff.�f���H��v AVAUATUSH�����
�v �X�L�%�v D�i�A��E�A��A��,��~tHc���H��v H����~QA�,@��
t��c��@��H��DP u�A��w@��\t�A8�u"A�|�\t�CH��H�H�2v ���fDH�!v A�H�=
v H��tH�t H�3�_��H�3�
�<`��[��u ]A\A]A^�ff.�f���AUA��ATI��USH��H�������N8f����1��1�H��A���K8��9�vt��+w�=�u � H�Iu �4�Hcƃ�+�
�S>����)�H�S0)�Hc�H�ƒ=wu w�H�zs �8u��:Ou��zTu�H����9�w��E�����K:f����1��fD�H��A���K:��9�vy��&w�=u �]H��t �4�Hcƃ�&�J�S@����)��S>)lj��H�S0H�H�ƒ=�t w�H��r �8u��:Ou��zTu�H����9�w�DE���O�K<f����1��!fD�H��A���K<��9������w�=Lt ��H��s �4�HcƁ�����SB����)��S@)lj��{>��H�S0H�H�ƒ=t w�H�r �8�w����:O�n����zT�d���H����9��p���H��L��H��N1�[�]A\A]��Hc�H�&s H���Hc�H�s H������DHc�H�s H�����DH�-Iq H�M��H�=N��_���K:f�������H�-q H�M��H�=�M�_�����f.�H�-�p ��H�=�MH�M�_���K8f�������t���ff.�f���SH��dH�%(H��$1�H�G H���H�B�H���w3D�E��t*A��L�ZI����L�����A��tH��9�v0�ƀ9u�H��$dH3%(��H��[�f�I�� 1�L���H�A���up1�1�@A�H�ׄ�t,�I�P H�~H��H����:I�P H���H�H��H��H��H=u�E��tD�I�@ H���H�|0��S���@I��E�S��E���{���A���j�����Z��D��ATI��UH�-�OS1�@H��L���}[����t��H����u�[1�]A\�fDH��H�uO�[]A\�f.���ATUH��SH���=Z��H��I���2Z��1�I9�uL��H��H���Y������[��]A\Ð��AWI��AVI��AUA��ATL�%4h UH�-4h SL)�H���OS��H��t1��L��L��D��A��H��H9�u�H��[]A\A]A^A_�ff.����f.����H��g 1��\����H��H���XYZ%drepeated cursor control %s
inconsistent prefix for %s
BADC39;4949;39Did not find delay %sstrdupwcopy_input (source)copy_input (target)%s: %s is not a text-file
r+lmkjtuvwqxnPQRSwxymtuvlqrsPpn (capability "%s") capability "%s"sgr(%d) present, but not %sstack error in sgr(%d) string"%s" SGR-attribute used in %skDCcsrproportional delayget_fkey_listcheck_conflict... is the same as, %d%cexpected numeric 2..15 '%s'smgbp%s omits parameter %d+-.%f%cfunction-key %s has delayflashbeepexpected a delay in %stic-expansion of %s failedtic-conversion of %s failedsetfsetbsetafsetabcheck_infotocap(%s)
...ti '%s'
...tc '%s'
\136hard_copygeneric_typeexpected parm_down_cursorexpected parm_up_cursorexpected parm_left_cursorexpected parm_right_cursorexpected cursor_upexpected cursor_downexpected cursor_leftexpected cursor_rightqsrpn ka1 ka3 kb2 kc1 kc3key_ic but no key_dcparm_up_micro but no micro_upXMscreenclear_all_tabs but no set_tabexit_attribute_modestack error in sgr(0) stringenter_standout_modeenter_underline_modeenter_reverse_modeenter_blink_modeenter_dim_modeenter_bold_modeenter_secure_modeenter_protected_modeenter_alt_charset_modesgr(0) did not return a valuemissing sgr stringexit_italics_modeexit_standout_modeexit_underline_modeset_a_foregroundset_a_backgroundset_foregroundset_backgroundtrimmed sgr0 is emptyUsage: %s %s
-<stdin>%s: %s %s
%s: %s is not a file
%s: Can't open %s
make_namelist%u:%s
|/etc/termcapcaptoinfoinfotocapTERMINFO%s: %s (no permission)
TERMCAPTERMtmpnamput_translate namebufput_translate suffix# length=%d
%d entries written to %s
No entries written
clearcwincud1homemrcupllcuu1dl1hdffil1neldlcudindnilrincuumc0vpahukDNkindkENDkHOMkLFTkNXTkPRVkRITkUPkriticinconsistent length for %s, expected %d
inconsistent suffix for %s, expected %c, have %c
checking sgr(%s) %s
	compare to %s
	unmatched %sacsc has odd number of charactersacsc refers to 'I', which is probably an erroracsc is missing some line-drawing mapping: %sunexpected column_address, for %sunexpected cursor_address, for %sunexpected cursor_home, for %sunexpected cursor_mem_address, for %sunexpected cursor_to_ll, for %sunexpected row_address, for %s%s differs from sgr(%d)
	%s=%s
	sgr(%d)=%ssgr(%d) missing, but %s present%s matches exit_attribute_modeConflicting key definitions (using the last)expected '%s' rather than '%s'expected numeric suffix for '%s'expected character after %% in %sexpected digit after %%p in %sextended %s capability has %d parameters%s refers to parameter 0 (%%p0), which is not allowed%s uses %d parameters, expected %dtparm will use %d parameters for %stparm analyzed %d parameters for %s, expected %dsyntax error in %s delay '%.*s'%s in %s is used since no xon/xoffexpected delay embedded within %stparm-conversion of %s(%d) differs between
	terminfo %s
	termcap  %stic-conversion of %s changed value
	from %s
	to   %stermcap equivalent of %s cannot use embedded delayinconsistent values for max_colors (%d) and max_pairs (%d)set_background but no set_foregroundset_foreground but no set_backgroundset_a_background but no set_a_foregroundset_a_foreground but no set_a_backgroundinitialize_pair but no set_color_pairset_color_pair but no initialize_pairexpected setf/setaf to be differentexpected setb/setab to be differentexpected either op/oc string for resetting colorsexpected initc or initp because ccc is givenexpected ccc because initc is giventerminal lacks cursor addressingterminal lacks cursor column-addressingterminal lacks cursor row-addressingparm_insert_line but no insert_lineparm_delete_line but no delete_lineparm_insert_line but no parm_delete_lineparm_down_cursor but no cursor_downparm_up_cursor but no cursor_upparm_left_cursor but no cursor_leftparm_right_cursor but no cursor_rightvt100 keypad order inconsistent: %svt100 keypad map incomplete:%sexit_doublewide_mode but no enter_doublewide_modeenter_doublewide_mode but no exit_doublewide_modeexit_italics_mode but no enter_italics_modeenter_italics_mode but no exit_italics_modeexit_leftward_mode but no enter_leftward_modeenter_leftward_mode but no exit_leftward_modeexit_micro_mode but no enter_micro_modeenter_micro_mode but no exit_micro_modeexit_shadow_mode but no enter_shadow_modeenter_shadow_mode but no exit_shadow_modeexit_subscript_mode but no enter_subscript_modeenter_subscript_mode but no exit_subscript_modeexit_superscript_mode but no enter_superscript_modeenter_superscript_mode but no exit_superscript_modeexit_upward_mode but no enter_upward_modeenter_upward_mode but no exit_upward_modestart_char_set_def but no stop_char_set_defset_bottom_margin_parm but no set_bottom_marginset_left_margin_parm but no set_left_marginset_right_margin_parm but no set_right_marginset_top_margin_parm but no set_top_marginparm_down_micro but no micro_downparm_left_micro but no micro_leftparm_right_micro but no micro_rightScreen's XT capability conflicts with XMScreen's "screen" entries should not have XT setValue of kmous inconsistent with screen's usageExpected kmous capability with XTExpected bce capability with XTExpected orig_colors capability with XT to have 39/49 parameters"tsl" capability is redundant, given XTExpected XT to be set, given kmouscursor_invisible but no cursor_normalcursor_visible but no cursor_normalcursor_visible is same as cursor_normalchange_scroll_region but no save_cursorchange_scroll_region but no restore_cursornon-curses applications may be confused by ich1 with smir/rmirnon-line capability using proportional delay: %sEntries that will be compiled:
0123456789CDIKLNQR:TUVWace:fGgo:qrstvwx%s: Too many file names.  Usage:
	%s %s%s: File name needed.  Usage:
	%s %s%s: resolved %s entry is %d bytes long
Y�����������$���m���8L���K��HG��HG��hK��HG���L��HG��nL���L��HG��?K��HG��HG��K���J��HG���J���J���J��lJ��HG��HG��HG��HG��HG��HG��HG��HG��HG���F��HG��FJ��HG��+J��J���I��HG��HG��HG��HG��HG��HG��HG���I��HG���I��}I��zH��7H��HG���G���G���F��Options:
  -0         format translation output all capabilities on one line
  -1         format translation output one capability per line
  -a         retain commented-out capabilities (sets -x also)
  -C         translate entries to termcap source form
  -D         print list of tic's database locations (first must be writable)
  -c         check only, validate input without compiling or translating
  -e<names>  translate/compile only entries named by comma-separated list
  -f         format complex strings for readability
  -G         format %{number} to %'char'
  -g         format %'char' to %{number}
  -I         translate entries to terminfo source form
  -K         translate entries to termcap source form with BSD syntax
  -L         translate entries to full terminfo source form
  -N         disable smart defaults for source translation
  -o<dir>    set output directory for compiled entry writes
  -Q[n]      dump compiled description
  -q    brief listing, removes headers
  -R<name>   restrict translation to given terminfo/termcap version
  -r         force resolution of all use entries in source translation
  -s         print summary statistics
  -T         remove size-restrictions on compiled description
  -t         suppress commented-out capabilities
  -U         suppress post-processing of entries
  -V         print version
  -W         wrap long strings according to -w[n] option
  -v[n]      set verbosity level
  -w[n]      set format width for translation output
  -x         treat unknown capabilities as user-defined

Parameters:
  <file>     file to translate or compile
S0birepchrcolornmcpicsnmcsrcubcudcufcupcuucvrcwindchdefcdialdispcdlechgetmhpaichilindninitcinitplpimc5pmrcupmvpapfkeypflocpfxpfxlplnqdialrcsdreprinsclkscpscsscsdsetabsetafsetbsetcolorsetfsgr	sgr1slengthslinessmgbpsmglpsmglrsmgrpsmgtbsmgtptslu6����vpawindwingononestandoutunderlinereverseblinkdimboldinvisprotectaltcharset[-e names] [-o dir] [-R name] [-v[n]] [-V] [-w[n]] [-1aCDcfGgIKLNrsTtUx] source-file
��������������������������$@��� ���@������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������������� ������������������ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789-_�����������������������������������������������������������������������������������hgn	ijk����������������������������������������	
�����������fl+,�����co��pqd��pe�z{|}~���mq�/.r��������r�ytuvwx0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abs�&5��
k
j�%)*./�0�2�4361ABDEFGHIJKCN�9;?TPM<>QRU@V87=XLO�SY:WZ[]^_`abcd\�' �fe!"��g*)�hwst�xvuz{|�~}y�lmno���+�#-���(� !"#$%&'(�,$-
�i
 $"#%&	
!() !"#$%	

'&*+���������������tsr�0123�b
ku	

v4jz�w�56�7�8�9:;{!"�} <#=>�$?��%&�'()@*ABC|~D+EF,G�-./f0123�+,456���7�����89����:;<=>��?@�ABC���������D����������E����������F����������G�H	
IJK��LMNOP��c��Q��R��������S������������T�����������U������V���WXYZ[\]^_`abcd�����efHIJKLMdgN*)�hijkOlmnoPpQqrRstiu�v�wxy�ez{|}~����Slmno�hg�/TUx-.Vpy�W�qXY�Z[\]^_���`��� !"#$%&'(��a$ "%	
!
#&%#&(* 	
)$
'+!"������������������tsr�2
	u0kbokp
r3iv4jzj`%�
���w���.-/f���l43n5�m+, 6�012��������������������������������7�����9���:O=SW;<@?���ABC���������D����������E����������F����������G�H	
IJK��LVMNTPc���Q���R������U>�����8�Z[\]^_`abcd1vwx�PJOIQKRM��HdLg*)hstui�N!\~]ye"}��qAB&�()C*X�e�|~+,�z{|DEFG@lmnoZ���-S[6hg/x.�'�7�y8�TUVpWXqY9Y�f{}#$�:;<=>^?_5� !"#$%&'(����a$"#%&! 
	
()%'&*+# 	
$
"!strncpy_DYNfill_spaces\
	 %*spPg,SVr1SVR1UltrixHPAIXBSD
	\
	:%p%;%%s: %%%c without %%? in %s?e;%s: %%; without %%? in %s\s%#xlqkxjmwuvtn%s@%s#%s: value for %s is too long
meml=%smemu=%solder termcapterminfohex:%02Xb64:==lf%dkf%duse=tc=%s%s    comparing booleans.
    comparing numbers.
    comparing strings.
use# (rmacs/smacs removed for consistency)%s: sorting by term structure order
%s: sorting by terminfo name order
%s: sorting by C variable order
%s: sorting by termcap name order
%s: width = %d, tversion = %d, outform = %d
%s=!!! %s WILL NOT CONVERT !!!# (untranslatable capabilities removed to fit entry within %d bytes)
# (%s removed to fit entry within %d bytes)
# (sgr removed to fit entry within %d bytes)
# (acsc removed to fit entry within %d bytes)
# (terminfo-only capabilities suppressed to fit entry within %d bytes)
# (some labels capabilities suppressed to fit entry within %d bytes)
# (some function-key capabilities suppressed to fit entry within %d bytes)
%s: %s entry is %d bytes long
# WARNING: this entry, %d bytes long, may core-dump %s libraries!
pkey_keypfkeypkpkey_localpflocplpkey_xmitpfxpxplab_normplnpnpkey_plabpfxlxl;�9������0��h�#����$��H�$��\@%��pp&���@'���p'��*��d�,����,���@/��`/��8@0��p01����1����2��`4��H�5��� 6���p6����6���8��h�8���;���p��l�p���0q����r���0u��0�u����v����w��	x��	�x��h	@y���	�y���	0z��
�z�� 
P����
p����
0����
����0���,@���x@������$��L�������P�������� 
�P
`����
p����
zRx��!��/D$4���@FJw�?:*3$"\���0tP"���L"���,��"��'B�D�D ��
ABC@��#���B�B�E �A(�A0�G@�
0A(A BBBAT$��'A�e`,h$���B�B�E �B(�D0�A8�G�p�B�A�A�P�^
8A0A(B BBBEH��&���B�B�E �E(�G0�E8�Dp�
8A0A(B BBBF��(��9A�\
CPH�)��]B�E�B �E(�G0�D8�G@�
8C0A(B BBBJH+��AAD4d +���A�A�G �
AADD
CAA8��+���B�B�A �A(�G�z
(A ABBA$�|,��YK�A�G @DAD�,��EB�B�B �A(�A0�G� I� �
0A(A BBBA(H�-��{A�A�G�B
AAC4t/��rA�D�G q
AAA�
MAL0�X0��?A�C�D J
CAJZAC�d0��OE�V
En(�0��xE�A�G qA�O�d,�0���B�H�E �E(�A0�A8�F@JHIPIXI`K@u
8D0A(B BBBBrHGP\HA@4�2��UB�D�I �g
KDKAABd�82��'B�B�B �B(�A0�D8�Dpe
8A0A(B BBBHc
8T0A(E DBBK`44���5F�B�B �B(�D0�A8�G�8
8A0A(B BBBF�
�J�H�B�I��i��9L�c
AD�<i��RA�0��i���B�I�A �T�U
 AABGT�j��oB�B�B �B(�A0�A8�G� L�@I�@)
8A0A(B BBBG4\�l��WB�A�D �v
FBKACBt�����F�B�B �B(�A0�A8�H��Q
D�����D��A��B��\�����E��B��B��\���l��W �m���4�n��lHH�n���B�B�A �D(�D0F
(C ABBEZ(A ABB8�0o���B�D�A �A(�D0X
(A ABBF8��o���B�E�E �D(�G0U
(A ABBA$�o��RA�G Q
MJVG4 p���D�dL�p���B�B�B �B(�D0�C8�F��
8A0A(B BBBG
8D0A(B BBBE��v��A�Q(��v���E�n
Eb
Fb
Nc8�Xw��nF�C�G �M
ABH
ABH8	�{���E�~
AHX	�{��B�E�B �I(�D0�H8�J`�
8D0A(B BBBFP�	�����F�B�B �B(�A0�A8�G� L�!�
8A0A(B BBBGT�	l����F�B�B �B(�A0�A8�H��Q
G��Q
8A0A(B BBBG$P
�����E�G� I� y
AA8x
�����M�B�B �A(�A0��(G BBB8�
P���#F�E�D �A(�G0 
(M FBBB �
D���;E�G�y
AJ4`���SF�D�H �b
CBGOAB,L����?F�A�D �nCBD|����eF�E�E �E(�H0�H8�G@n8A0A(B BBB�����������D�D�8!Y���>������������������������������������������
�1��U��	�����"�'�,�0��#
���8!�8!���o0X`
GP<!���	���o���o����o�o����o,@:!�#$$ $0$@$P$`$p$�$�$�$�$�$�$�$�$%% %0%@%P%`%p%�%�%�%�%�%�%�%�%&& &0&@&P&`&p&�&�&�&�&�&�&�&�&'' '0'@'P'`'p'�'�'�'�'�'�'�'�'(( (0(@(P(`(p(�(�(�(�(�(�(�(�())4���<'�'�GA$3a1�#/DGA*P.��GA$annobin gcc 8.5.0 20210514GA$running gcc 8.5.0 20210514GA*GA*GA!
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA$3p1113P.��GA$plugin name: annobinGA*GOW*�GA$3a10D��GA*���GA$annobin gcc 8.5.0 20210514GA$running gcc 8.5.0 20210514GA*GA*GA!
GA*FORTIFYGA+GLIBCXX_ASSERTIONSGA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA$3p1113�?�GA$plugin name: annobinGA*GOW*�GA$3p1094@���GA$plugin name: gcc-annobinGA*GOW*GA$3p1094����GA$plugin name: gcc-annobinGA*GOW*
GA*FORTIFY�DוGA+GLIBCXX_ASSERTIONS
GA*FORTIFY���GA+GLIBCXX_ASSERTIONStic-6.1-10.20180224.el8.x86_64.debug���7zXZ�ִF!t/��/]?�E�h=��ڊ�2N�t��K��֭.8�\|K-� T��j���a�h�\�M�'Q�=�O�g��K�[��M���/=.�����z��n��
뫮H�M�X�5���`�>{��g�{#F���4��'6���aM����l�P4韯�`lTǯʱ���R��ȍ��:�$�_��z�֤�.�������'I�n�/�~U�$�m!�p_u����?�j�
7/��C؜��qR`^�)�_�����K�
�v�׊�A�X�c��+`T�N��?���4Sz�'R��h)�w�.��t��M�n*���#8�S2�,��Z,�K�48�G��w�VKb�u��S���¨d�?��"<s�h]m�t���WZBl�5̚`�c��dn���7Q�c���?�NU��~#<�!��r��l�S84�TI67Y�%V���س�l�)j�'��҆�֞L��mv/,�2K7�A�����'��5m��ٸ�E��=�<b��N�]�hUA:�CqYy�u���-P��ª����`|?bD�za��s䓤_M	h6��o��;Ŵ�	RnԈ�ˬw�� �#��R����)��dw_VoS-����q��lj�~�d%ސ)�]2O�6��0������X9�՛�a���^�qe��#��MIDy#;deE���:@��1R{%:5<
1A�M��[�oX{����pH��K���5�� ~&\�yIZ�OG�E����8��8�qs/��gjw��sq��Ud�+v!���OJ�זȀ�!}����+�K��
\��
����&+Cb��Y_��n�[f���04��\'m`�U�ݗ<��,������MПӗȵn�J)�*�J
`L)��(�A�a�+��=	�M��6�/��{Ț1�N�vk�!$QT%�.o�e�����žh�	��5����L�Y3_7�~��u'i7s�X*�X
�	�Gzі/^
G���s��0Ўx�>�P�(�iz�5��ϮWc�۱�4�V/KsU`;�J!�EkDP�`��"s){A5�;-�NoW�ZHKt������3W�)C/�>�:�d��o��\v8�e\�L�ڻa�彃=mD�s�j͝s!t��!T�%��&��o@�#�O:!G��R�	�LQpV�J�Xś! g��V���$��W��3�Kv~��쏆5�v��v���f���T�]nU(�Uwت��\����Cpr����Hy�mQ�ۇ]e<����Kc+n��zA�����s�3"�3�J~U�`�I�g��Ko2�i�^䌔�q�o����aef1�m����X�WF�e�_�� �R��6md�WI��hH��W�a0&�O{�-D��[n����GCv����>�Q��!7���l�SO�:w�0��e���\P�)'��Gw��6kQ��z��}o��6�D�x-3Y�_ַ��J��sp�`���4�=����2�8�BRq��)�5�ъsz��\`91���ib����#1)/�db4� [㾊=+Y"�g�f��
��d�ʢ֙����.�,U���g�YZ.shstrtab.interp.note.gnu.property.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu.build.attributes.gnu_debuglink.gnu_debugdata���� &�� 4$G���o000Q``�
YXXGa���o���n���o��`}���B�����#�#��#�#@� ) )0�P.P.�������
���PO �P P ��("("���8!�8��8!�8��8!�8� �@:!@:�P<!P<��@!@00@!0@
@Aa0@� �E,/�E`<L>

SILENT KILLER Tool